Marinobacter nauticus VT8: Maqu_0922 Help Entry Maqu_0922         CDS       T00454                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism maq  Marinobacter nauticus VT8 Brite KEGG Orthology (KO) [BR:maq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maq03036]     Maqu_0922 Chromosome and associated proteins [BR:maq03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Maqu_0922 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB YabA SlyX Motif Other DBs NCBI-ProteinID:  ABM18018 UniProt:  A1TZ49 LinkDB All DBs Position 1054454..1054726 Genome browser AA seq 90 aa AA seqDB search MKSLWAILVVLILLLQVRLWIGEGSFAQVWALEQSIAEQREENAELAARNDRLYAEVRNL RNEQGAVEERARMNLGLIREDETFFLVVEN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaatcgctttgggccattctggtagtgctgatactcctgctgcaggttcgcctgtgg atcggggagggcagttttgcgcaggtgtgggccctggagcagtcgattgccgagcagcgg gaagagaatgccgagttggcggcccggaatgaccggctttatgcggaggtgcggaatctt cgcaatgagcagggcgccgttgaggagcgggcccggatgaatcttggcctgattcgtgag gatgagacgttctttctcgttgttgaaaattga

DBGET integrated database retrieval system