KEGG   Massilia violaceinigra: CR152_15980Help
Entry
CR152_15980       CDS       T05157                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mass  Massilia violaceinigra
Brite
KEGG Orthology (KO) [BR:mass00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CR152_15980
Enzymes [BR:mass01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CR152_15980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 K_oxygenase FAD_oxidored DAO FAD_binding_3 NAD_binding_8 Thi4 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ATQ75858
UniProt: A0A2D2DLJ9
LinkDB All DBs
Position
3574596..3576197
Genome map
AA seq 533 aa AA seqDB search
MLDATLKTQLQGYLQNLSAPIRLIATLDHSEKSAELRELLAEISSLSDKVSVDESGTDSR
KPSFVIAREGETHGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEPEVIEAIKALDEAMDF
DVYMSLSCHNCPDVVQAATLMAVFNPKIRTVIIDGGLFPSEVETRQVMAVPMVFKNDTMF
TSGHMTVEELVAKLDVNSAEREAKKLNQKSAFDMLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQVNDTMAIENYISVLETDGPKFAAALEAQVRHYEVDIMNLQRAERIVPAATPGG
LVEVHMQNGGVLKARSVIVSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVQHVTLVEFADALKADAVLVNKLKSLSNVTIHVNAQTTEITGDG
QKVNGLGYKDRATDTAHHVALEGVFVQIGLVPNTEFLKGTLELSKYGEIVVDAKCHTSVP
GVFAAGDVTTVPYKQIVVAAGEGSKAALSAFDYLIRQPVVSSVANEEEVALAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgccactctcaaaactcagttgcaaggctatttgcaaaacctgagcgcgccg
attcgtctcatcgcaacgctcgatcacagcgaaaaaagtgccgaactgcgtgaactgctg
gccgagatcagcagcctgtccgataaagtcagtgttgacgagtcgggcaccgatagccgc
aagccctcgtttgtcattgcccgcgaaggcgagacccacggcgtgcgcttcgccgccatt
ccgctcggccatgaattcacctcgctggtgctggccctgctgtggaccggcggccatccg
ccgaaagtggaaccagaagtgatcgaggccatcaaggcgctcgatgaagccatggatttc
gacgtgtatatgtccctgtcctgccacaattgccccgacgtggtgcaggcagcgacgctg
atggcggtcttcaatccgaagatccgtaccgtgatcatcgacggtggtttgttcccgtcg
gaagtcgagacgcgccaggtgatggcggtcccgatggtcttcaagaatgacacaatgttt
acctccggtcatatgaccgtggaagaactcgtcgccaagctcgacgtgaactcggctgaa
cgtgaagccaaaaagctcaatcagaagtccgccttcgacatgctgatcgtcggcggcggc
ccggccggcgcggcggcagcggtgtacgcggcacgcaaaggcatccgtgtcggcgtggcg
gcggagcgcttcggcggccaagtcaacgacaccatggccatcgaaaactatatctcggtg
ctggaaacggacggccccaaattcgccgccgccctcgaggcgcaggtccggcactatgaa
gtcgacatcatgaacctgcagcgggccgagcgcatcgttcccgccgctaccccgggtggc
ctggtcgaagtacacatgcaaaacggcggcgtgctcaaggcccgcagcgtgatcgtctcg
accggcgcgcgctggcgcaacgtcaacgtgcccggcgaagccgagtacaagaacaagggc
gtggcgtactgcccgcattgcgacggccccttgttcaaaggcaagcgcgtagcggtgatt
ggcggcggcaactcgggcgtggaagcggcgatcgacctggcgggcatcgtccagcacgtg
accctggtcgagtttgccgatgcgctcaaggccgacgcggtcctggtcaacaagctcaag
agcctctccaacgtcacgatccacgtgaatgcccagaccaccgagattaccggtgacggc
caaaaggtcaatggcctgggctacaaggaccgtgccaccgatacggcgcatcacgtggcg
ctggaaggcgtgttcgtgcaaatcgggctggtgccgaataccgaattcctgaaagggact
ttggagctgagcaagtacggcgagattgtcgtcgatgccaaatgccacaccagtgtgccg
ggcgtgtttgccgccggcgatgtgaccacggtaccgtacaagcagatcgtcgtcgccgcg
ggcgaaggatcgaaagccgcgctcagtgcgttcgactacctgattcgccaacccgtggtg
agcagtgttgccaatgaagaggaagtagcgctggcagcctga

DBGET integrated database retrieval system