Mycobacterium avium 104: MAV_1694 Help Entry MAV_1694          CDS       T00433                                  Symbol ssb Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism mav  Mycobacterium avium 104 Pathway mav03030   DNA replication mav03430   Mismatch repair mav03440   Homologous recombination Brite KEGG Orthology (KO) [BR:mav00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     MAV_1694 (ssb)    03430 Mismatch repair     MAV_1694 (ssb)    03440 Homologous recombination     MAV_1694 (ssb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mav03032]     MAV_1694 (ssb)    03400 DNA repair and recombination proteins [BR:mav03400]     MAV_1694 (ssb)    03029 Mitochondrial biogenesis [BR:mav03029]     MAV_1694 (ssb) DNA replication proteins [BR:mav03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MAV_1694 (ssb) DNA repair and recombination proteins [BR:mav03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      MAV_1694 (ssb)   TLS (translesion DNA synthesis) factors    Other SOS response factors     MAV_1694 (ssb) Mitochondrial biogenesis [BR:mav03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     MAV_1694 (ssb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  ABK67207 UniProt:  A0A0H2ZYT4 LinkDB All DBs Position 1666414..1666896 Genome browser AA seq 160 aa AA seqDB search MFETPLTVVGHIVNNPERRQVGAQEVIKFRVASNSRRRTADGGWEPGNSLFINVNCWGRL VTGVGAALGKGAPVIVVGHVYTSEYEDRDGNRRSSLEMRATSVGPDVSRAIVRIEKPGYT GPSTDEAAPAAAEAADAAGEDADRGDTVEPVDTGPVPLSA NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgttcgaaaccccgctgaccgtggtcggtcacatcgtcaacaaccccgaacgacgccag gtcggcgcccaggaggtcatcaagtttcgcgtcgcgagcaattcgcgccgccgcaccgcc gacggcggctgggagccgggcaactcgctgttcatcaacgtcaattgctggggccggctg gtcaccggggtgggcgccgcgctgggcaagggcgcaccggtgatcgtggtgggccacgtc tacaccagcgaatacgaggaccgcgacggcaaccgtcgctcgtcgctggagatgcgggca acctccgtcgggcccgatgtgtcccgcgcgatcgtgcgcatcgagaagcccggctacacc ggtcccagcaccgacgaggccgccccggccgcggcggaggcggccgacgccgctggtgag gacgccgatcgcggcgacaccgtcgagcccgtcgacacgggcccggtgccactgtccgct tag

DBGET integrated database retrieval system