KEGG   Methanosarcina barkeri 227: MSBR2_2223
Entry
MSBR2_2223        CDS       T03914                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00300  Lysine biosynthesis
mbar01100  Metabolic pathways
mbar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSBR2_2223
Enzymes [BR:mbar01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSBR2_2223
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 2-Hacid_dh_C UDPG_MGDP_dh_N 3HCDH_N
Other DBs
NCBI-ProteinID: AKB58739
UniProt: A0A0E3R323
LinkDB
Position
complement(2916352..2917143)
AA seq 263 aa
MAIKMALLTPNDLININKQLQEADSVVKRVTGLDIKGVCQSLYGTSPSSKKVGIVPVTSG
NGIIGNFSASLHVITQYFGFDGFVTDMPDVSGYYEAVQNGAEIILMADDHTFLAHNIKNG
KMANNQPCTGIIYAEIASRYLKADSKDVLVMGLGKVGFPGAAQLVQKGFRVYGYDPDARL
LKRAVSNLGIIPFDPANPKKFSIIFEATPCANTIPEAVLSENCVLSTPGIPCAISEELKN
KYDVQLVAEPLGIGTVSMLYSVL
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgataaaaatggcacttttaacccccaatgatttgataaatattaataagcagctt
caggaagctgactctgtcgtgaaaagagtaacagggcttgatataaaaggcgtctgtcaa
tctctttatggtacttcccctagctccaaaaaagtaggcatcgtgcctgtaacttcagga
aacgggataataggaaacttctcggcttccttacatgtaattacgcagtatttcggattt
gacggttttgttacggatatgccggatgttagcggctattatgaagctgtgcagaacgga
gccgagatcatccttatggcagacgatcacactttccttgctcataacatcaaaaatgga
aaaatggccaataatcaaccctgcacaggtataatttatgctgagatcgcttccagatac
ctgaaagccgactcaaaggacgtacttgttatggggctcggaaaggtaggttttcccgga
gcagcccaacttgtgcagaaaggcttcagggtttacgggtatgatcctgatgcaagactc
cttaagagagccgtttcaaacctcgggattattcctttcgaccctgcgaatccaaaaaag
ttttccattatcttcgaggcgaccccatgcgcaaacacgattcctgaagctgtactttcg
gagaattgcgtgctttccaccccaggaattccctgcgcaatttctgaagaacttaaaaat
aaatatgatgttcaacttgtagcggagccccttggaataggaacggtatcaatgttgtat
tctgtgctctaa

DBGET integrated database retrieval system