KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB0963Help
Entry
BQ2027_MB0963     CDS       T00132                                 

Gene name
ligd
Definition
(RefSeq) atp dependent dna ligase ligd (atp dependent polydeoxyribonucleotide synthase) (thermostable dna ligase) (atp dependent polynucleotide ligase) (sealase) (dna repair enzyme) (dna joinase)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BQ2027_MB0963 (ligd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mbo03400]
    BQ2027_MB0963 (ligd)
Enzymes [BR:mbo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BQ2027_MB0963 (ligd)
DNA repair and recombination proteins [BR:mbo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BQ2027_MB0963 (ligd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 1093039
NCBI-ProteinID: YP_009358296
Pasteur: Mb0963
LinkDB All DBs
Structure
PDB: 

Position
1046603..1048882
Genome map
AA seq 759 aa AA seqDB search
MGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQ
PAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAE
PGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLY
TPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAP
YSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTRY
RRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLERDGVLVSWAVPKNLPDN
TSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDDPHTGEVIVNL
HGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHGTVAGLKASQWAFEG
KWDGYRLLVEADHGAVRLRSRSGRDVTAEYPQLRALAEDLADHHVVLDGEAVVLDSSGVP
SFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELLPGDG
AQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWRAGEGGRSSGV
GSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFDVPLPARDAKGITYV
KPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgtcggagcaacgggtgacgctgaccaacgccgacaaggtgctctatccc
gccaccgggaccacaaagtccgatatcttcgactactacgccggtgttgccgaagtcatg
ctcggccacatcgcgggacggccggcgacgcgcaagcgctggcctaacggcgtcgaccaa
cccgcgttcttcgaaaagcagttggcgttgtcggcgccgccttggctgtcacgtgcaacg
gtggcgcaccggtccgggacgacgacctatccgatcatcgatagcgcaaccgggctggcc
tggatcgcccaacaggcggcgctggaggtgcacgtgccgcagtggcggtttgtcgccgag
cccggatcaggtgagttaaatccgggcccggcaacgcgtttggtgttcgacctggacccg
ggcgaaggcgtgatgatggcccagctggccgaggtggcgcgcgcggttcgtgatcttctc
gccgatatcgggttggtcaccttcccggtcaccagcggcagcaagggattgcatctgtac
acaccgctggatgagccggtgagcagcaggggagccacggtgttggccaagcgcgtcgcg
cagcgattggagcaggcgatgcccgcgttggtcacctcgaccatgaccaaaagcctgcgg
gccgggaaggtgtttgtggactggagccagaacagcggctcgaagaccaccatcgcgccg
tactcactacgtggccggacgcatccgaccgtcgcggcgccacgcacctgggcggagctc
gacgaccccgcactgcgtcagctctcctacgacgaggtgctgacccggattgcccgcgac
ggcgatctgctcgagcggctggatgccgacgctccggtagcggaccggttgacccgatac
cgccgcatgcgcgacgcatcgaaaactcccgagccgattcccacggcgaaacccgttacc
ggagacggcaatacgttcgtcatccaggagcatcacgcgcgtcggccgcactacgatttc
cggctggaacgcgacggcgtgctggtctcgtgggcggtaccgaaaaacctgcccgacaac
acatcggttaaccatctagcgatacacaccgaggaccacccgctggaatacgccacgttc
gagggcgcgattcccagcggggagtacggcgccggcaaggtgatcatctgggactccggc
acttacgacaccgagaagttccacgatgacccgcacacgggggaggtcatcgtgaatctg
cacggcggccggatctctgggcgttatgcgctgattcggaccaacggcgatcggtggctg
gcgcaccgcctaaagaatcagaaagaccagaaggtgttcgagttcgacaatctggcccca
atgcttgccacgcacggcacggtggccggtctaaaggccagccagtgggcgttcgaaggc
aagtgggacggctaccggttgctggttgaggctgaccacggcgccgtgcggctgcggtcc
cgcagcgggcgcgatgtcaccgccgagtatccgcaattgcgggcattggcggaggatctc
gccgatcaccacgtggtgctggacggcgaggccgtcgtacttgactcctctggtgtgccc
agcttcagccagatgcagaatcggggccgcgacacccgtgtcgagttctgggcgttcgac
ctgctctaccttgacggccgcgcgctgctaggcacccgctaccaagaccggcgtaagctg
ctcgaaaccctagctaacgcaaccagtctcaccgttcccgagctgctgcccggtgacggc
gcccaagcgtttgcgtgctcgcgcaagcacggctgggagggcgtgatcgccaagaggcgt
gactcgcgctatcagccgggccggcgctgcgcgtcgtgggtcaaggacaagcactggaac
acccaggaagtcgtcattggtggctggcgcgccggggaaggcgggcgcagcagtggcgtc
gggtcgctgctcatgggcatccccggtccaggtgggctgcagttcgccgggcgggtcggt
accggcctcagcgaacgcgaactggccaacctcaaggagatgctggcgccgctgcatacc
gacgagtcccccttcgacgtaccactgcccgcgcgtgacgccaagggcatcacatatgtc
aagccggcgctggttgcagaggtgcgctacagcgagtggactccggagggccggctgcgt
caatcaagctggcgtgggctgcggccggacaagaaacccagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system