KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB3351CHelp
Entry
BQ2027_MB3351C    CDS       T00132                                 

Definition
(RefSeq) POSSIBLE METHYLTRANSFERASE
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_15 TPMT
Motif
Other DBs
NCBI-GeneID: 32288911
NCBI-ProteinID: YP_009360712
Pasteur: Mb3351c
LinkDB All DBs
Position
complement(3667373..3667987)
Genome map
AA seq 204 aa AA seqDB search
MSVQTDPALREHPNRVDWNARYERAGSAHAPFAPVPWLADVLRAGVPDGPVLELASGRSG
TALALAAHGRQVTAIDVSDVALLQLDSEAVRRGVADRLNLVQADLGCWEPGETRFALVLS
RLFWDAAIFHRACEAVMPGGVLAWESLALSGAEAGTASAKRRVKPGEPACLLPADFTVVH
EGQGNCDSAPSRIMIARRSPLPGA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcagacggatccggcgctgcgggagcaccccaaccgcgtcgactggaacgcg
cgatacgaacgcgcgggttcggcgcacgcgccgtttgccccggtgccttggctcgccgat
gtcctcagagcaggcgttccggacggtcccgttctggagttagctagcggtcgatcgggt
accgcactggcgttggccgcccacggccgccaggtcaccgcaatcgatgtgtccgatgtc
gcgctgctgcagctggacagcgaggccgtgcgtcgaggcgtggccgatcggctcaacctc
gtgcaggccgacttgggctgctgggaacccggcgagacgcgtttcgcgctggtgctcagc
aggctcttttgggatgcggcgatatttcaccgcgcctgtgaggcggtgatgccaggcggc
gtattggcatgggagtcgctggctctcagtggcgccgaggcgggcacagccagcgcgaag
cgacgtgtcaagccgggagagccagcgtgtctgcttcctgccgacttcaccgttgtacac
gaggggcagggtaactgcgattcggcgccgtcgcggatcatgatcgcgcggcgctcaccg
ttgccaggggcatag

DBGET integrated database retrieval system