KEGG   Mycolicibacterium chubuense: Mycch_2310Help
Entry
Mycch_2310        CDS       T02150                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00250  Alanine, aspartate and glutamate metabolism
mcb00280  Valine, leucine and isoleucine degradation
mcb00410  beta-Alanine metabolism
mcb00640  Propanoate metabolism
mcb00650  Butanoate metabolism
mcb01100  Metabolic pathways
mcb01120  Microbial metabolism in diverse environments
Module
mcb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycch_2310
   00650 Butanoate metabolism
    Mycch_2310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mycch_2310
   00280 Valine, leucine and isoleucine degradation
    Mycch_2310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycch_2310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcb01007]
    Mycch_2310
Enzymes [BR:mcb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mycch_2310
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mycch_2310
Amino acid related enzymes [BR:mcb01007]
 Aminotransferase (transaminase)
  Class III
   Mycch_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFM17085
UniProt: I4BIH8
LinkDB All DBs
Position
complement(2368123..2369466)
Genome map
AA seq 447 aa AA seqDB search
MTALEQSRHLATAIPGPRSEELLARKGAAVARGIGNTMPVYASRAFGGIVEDVDGNRLID
LGSGIAVTTVGNASPRVVAAVAEQAQHFTHTCFMVTPYEGYVAVAEALNRLTPGTGEKRS
ALFNSGSEAVENAVKIARTYTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
VYRAPLSYPFRDAEFGGKELATDGELAARRAITVIDKQVGADNLAAVIIEPIQGEGGFIV
PAEGFLRTLLDWCRDNGVVFIADEVQTGFARTGAMFACEHEGIVPDLIVTAKGIAGGMPL
SAVTGRAEIMDAPHVGGLGGTYGGNPVACAAALATIETIETDGLVERARQIETLMKDKLG
RMQAEDDRIGDVRGRGAMIALELVKPGTTEPDAELTKAVSTAAHRAGVIVLTCGTFGNVL
RFLPPLTISDDLLLDGLDVLAEALRTL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctctcgaacagagccgccacctcgccaccgccattcccggtccgcgctccgag
gagctgctggcgcgcaagggtgccgcggtggcccgaggaatcggcaacacgatgccggtg
tacgcgtcgcgcgccttcggcggcatcgtcgaggacgtcgacggcaaccggctcatcgac
ctcgggtcgggcatcgcggtcaccaccgtcggcaacgcctcgccgcgggtggtcgccgcc
gtcgccgagcaggcgcagcacttcacccacacctgcttcatggtcaccccctacgagggg
tacgtcgcggtcgccgaggcgctcaaccggctcaccccgggcaccggggagaagcgttcg
gcgctgttcaactccggctccgaggcggtcgagaacgcggtcaagatcgcccggacgtac
acgcgcaagcaggccgtggtgtcgttcgaccacgcctaccacggtcgcaccaacctcacg
atggcgctgaccgccaagtcgatgccgtacaagcacggcttcggcccgttcgcccccgag
gtctaccgggcgccgctgtcgtatccgttccgggacgccgagttcggcggcaaggagctg
gccaccgacggtgaactggccgcccggcgggccatcaccgtgatcgacaagcaggtcggc
gccgacaatctggccgccgtgatcatcgagcccatccagggcgagggcggcttcatcgtc
ccggccgagggcttcctgcgcaccctgctggactggtgccgcgacaacggcgtcgtgttc
atcgccgacgaggtgcagaccggcttcgcgcgcaccggcgcgatgttcgcctgcgagcac
gagggcatcgtcccggatctcatcgtgacggccaagggcatcgccggaggcatgccgctg
tcggcggtcaccggccgcgccgagatcatggacgccccgcacgtcggcggcctgggcggc
acatacggcggcaacccggtggcgtgtgccgcagcgctggccaccatcgagacgatcgag
accgacggcctggtcgagcgcgcccgccagatcgagacgctgatgaaggacaagctgggc
cggatgcaggccgaggacgaccgcatcggagacgttcgcggccgcggcgcgatgatcgcg
ctcgaactggtcaagccgggcaccaccgagcccgacgcagaactgaccaaggcggtgtcc
acggcagcgcaccgggccggcgtgatcgttctgacatgcggcaccttcggcaacgtgctg
cgcttcctgccgccgctgacgatcagcgacgacctcctactcgacggtttggacgtcctc
gccgaggcccttcgcacgctctga

DBGET integrated database retrieval system