KEGG   Macaca mulatta (rhesus monkey): 693666
Entry
693666            CDS       T01028                                 

Gene name
ACTN4
Definition
(RefSeq) alpha-actinin-4
  KO
K05699  actinin alpha 1/4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05146  Amoebiasis
mcc05203  Viral carcinogenesis
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    693666 (ACTN4)
   04520 Adherens junction
    693666 (ACTN4)
   04530 Tight junction
    693666 (ACTN4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    693666 (ACTN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    693666 (ACTN4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    693666 (ACTN4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    693666 (ACTN4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    693666 (ACTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    693666 (ACTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    693666 (ACTN4)
   04147 Exosome [BR:mcc04147]
    693666 (ACTN4)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    693666 (ACTN4)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     693666 (ACTN4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   693666 (ACTN4)
  Exosomal proteins of colorectal cancer cells
   693666 (ACTN4)
  Exosomal proteins of bladder cancer cells
   693666 (ACTN4)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 693666
NCBI-ProteinID: NP_001248731
Ensembl: ENSMMUG00000006429
UniProt: A0A1D5QZ63
LinkDB
Position
19
AA seq 911 aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggtggactaccacgcggcgaaccagtcgtaccagtacggccccagcagcgcgggcaat
ggcgctggcggcgggggcagcatgggcgactacatggcccaggaggacgactgggaccgg
gacctgctgctggacccggcctgggagaagcagcagcgcaagaccttcacggcgtggtgc
aactcccacctgcggaaggcaggcacgcagatcgagaacatcgacgaggacttccgagac
gggctgaagctcatgttgctcctggaggtcatatcaggggagcggttacctaagccggag
cgggggaaaatgagagtgcacaaaatcaacaacgtgaacaaagcactggactttattgcc
agcaaaggcgtcaagctggtctccatcggggcagaagagattgtggacggcaacgcaaag
atgaccctgggaatgatctggaccatcatccttaggttcgccatccaggacatctccgtg
gaagagacctcggccaaggaagggcttcttctctggtgccagagaaagacagccccgtat
aagaacgtcaacgtgcagaacttccacattagctggaaggacggtcttgccttcaatgcc
ctgatccaccggcacagaccagagctgattgagtatgacaagctgaggaaggacgaccct
gttaccaacctgaacaatgccttcgaagtggctgagaaatacctcgacatccccaagatg
ctggatgcagaggacatcgtgaacacggcccgccccgacgagaaggccataatgacctat
gtgtccagcttctaccatgccttttcgggagcgcagaaggctgaaactgctgccaatcgg
atctgcaaggtgctggctgtcaaccaagagaacgagcacctgatggaggactacgagaag
ctggccagcgacctcctggagtggatccggcgcaccatcccctggctggaggaccgtgtg
ccccaaaagactatccaggagatgcagcagaagctagaggacttccgtgactaccggcgc
gtgcacaagccacccaaggtgcaggagaagtgccagctggagatcaacttcaacacgctg
cagaccaagctgcgcctcagcaaccggcctgccttcatgccctctgagggcaagatggtc
tcggacatcaacaacggctggcagcacttggagcaggctgagaagggctatgaggagtgg
ttgctgaatgagatccgcaggctggagcggctcgaccacctggcagagaagttccggcag
aaggcctccatccacgaggcctggactgacgggaaggaagccatgctgaagcaccgggac
tacgagacggccaccctgtcggacatcaaagccctcattcgcaagcacgaggccttcgag
agcgacctggccgcgcaccaagaccgcgtggagcagatcgccgccattgcccaggagctc
aacgagctggattactacgactcccacaatgtcaacacccggtgccagaagatctgcgac
cagtgggacgccctcggctctctgacccacagtcgcagggaagccctggagaaaacagag
aagcagctggaggccatcgaccagctgcacctggagtatgccaagcgcgcggcccccttc
aacaactggatggagagcgccatggaggacctccaggacatgttcatcgtccacaccatc
gaggagattgagggcctgatctcagcccatgaccagttcaagtccaccttgccggacgcc
gacagggagcgcgaggccatcctggccatccacaaggaggcccagaggattgctgagagc
aaccacatcaagctgtcgggcagcaacccctacaccactgtcaccccgcagatcatcaac
tccaagtgggagaaggtgcagcagctggtgccaaaacgggaccatgccctcctggaggag
cagagcaagcagcagtccaatgagcacctgcgccgccagtttgccagccaggccaacgtc
gtgggcccctggatccagaccaagatggaggagatcgggcgcatctccattgagatgaac
gggaccctggaggaccagctgagccacctgaagcagtatgaacgcagcatcgtggactac
aagcccaacctggacctgctggagcagcagcaccagctcatccaggaggccctcatcttc
gacaacaagcacaccaactacaccatggagcacattcgcgtgggctgggagcagctgctc
accaccattgcccgcaccatcaacgaggtggagaaccagatcctcacccgcgacgccaag
ggcatcagccaggagcagatgcaggagttccgggcatccttcaaccacttcgacaaggac
catggcggggcgctggggcccgaggagttcaaggcctgcctcatcagcctgggctacgac
gtggagaacgaccggcagggtgaggccgagttcaaccgcatcatgagcctggttgacccc
aaccacagcggccttgtgaccttccaagccttcatcgacttcatgtctcgggagaccacc
gacaccgacacggccgaccaggtcatcgcctccttcaaggtcctggcaggggacaagaac
ttcatcacagctgaggagctgcggagagagctgccccccgaccaggctgagtactgcatt
gcccgcatggcaccgtaccagggccccgacgctgtgcccggcgccctcgactacaagtcc
ttctccacagccctgtatggcgagagcgacctgtga

KEGG   Macaca mulatta (rhesus monkey): 711994
Entry
711994            CDS       T01028                                 

Gene name
ACTN1
Definition
(RefSeq) alpha-actinin-1 isoform X1
  KO
K05699  actinin alpha 1/4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05146  Amoebiasis
mcc05203  Viral carcinogenesis
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711994 (ACTN1)
   04520 Adherens junction
    711994 (ACTN1)
   04530 Tight junction
    711994 (ACTN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711994 (ACTN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    711994 (ACTN1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    711994 (ACTN1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    711994 (ACTN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    711994 (ACTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    711994 (ACTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    711994 (ACTN1)
   04147 Exosome [BR:mcc04147]
    711994 (ACTN1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    711994 (ACTN1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     711994 (ACTN1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   711994 (ACTN1)
  Exosomal proteins of colorectal cancer cells
   711994 (ACTN1)
  Exosomal proteins of bladder cancer cells
   711994 (ACTN1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_5 XisI
Other DBs
NCBI-GeneID: 711994
NCBI-ProteinID: XP_014999455
Ensembl: ENSMMUG00000010767
UniProt: A0A1D5QE04
LinkDB
Position
7
AA seq 914 aa
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQKKTGMMDTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSR
ETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYTGPDSVPGALD
YMSFSTALYGESDL
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggaccattatgattctcagcaaaccaacgattacatgcagccagaagaggactgggac
cgggacctgctcctggacccggcctgggagaagcagcagagaaagacattcacggcatgg
tgtaactcccacctccggaaggcggggacgcagattgagaacatcgaagaggacttccgg
gatggcctgaagctcatgctgctgctggaggtcatatcaggtgaacgcttggccaagcca
gagcgaggcaagatgagggtgcacaagatctccaacgtcaacaaggccctggatttcata
gccagcaaaggcgtcaaactggtgtccatcggagccgaagaaatcgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcatcctgcgctttgccatccaggacatctcc
gtggaagagacttcagccaaggaagggctgctcctgtggtgtcaaagaaagacggcccct
tacaaaaacgtcaacatccagaacttccacataagctggaaggatggcctcggcttctgt
gccttgatccaccgacaccggcccgagctgattgactacgggaagctgcggaaggatgat
ccactcacaaatctgaatacagcttttgatgtggcagagaagtacctggacatccccaag
atgctggatgccgaagacatcgttggaactgcccgaccggatgagaaagccatcatgact
tacgtgtctagcttctaccacgccttctctggagcccagaaggcggagacagcagccaat
cgcatctgcaaggtgttggccgtcaaccaggagaacgagcagcttatggaagactacgag
aagctggccagtgatctgttggagtggatccgccgcaccatcccgtggctggagaaccgg
gtgcccgagaacaccatgcatgccatgcagcagaagctggaggacttccgggactaccgg
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacg
ctgcagaccaagctgcggctcagcaaccggcccgccttcatgccctccgagggcaggatg
gtctcggacatcaacaatgcctggggctgcctggagcaggtggagaagggctatgaggag
tggttgctgaacgagatccggaggctggagcgactggaccacctggcagagaagttccgg
cagaaggcctccatccacgaggcctggactgacggcaaagaggccatgctgcgacagaag
gactatgagacggccaccctctcggagatcaaggccctgctcaagaagcatgaggccttc
gagagtgacctggctgcccaccaggaccgcgtggagcagattgccgccatcgcacaggaa
ctcaatgagctggactattatgactcacccagtgtcaacgcccgttgccaaaagatctgt
gaccagtgggacaatctgggggccctaactcagaagcgaagggaagctctggagcggacc
gagaaactgctggagaccattgaccagctgtacttggagtatgccaagagggccgcaccc
ttcaacaactggatggagggggccatggaggacctgcaggacaccttcattgtgcacacc
attgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctccctgat
gctgataaggagcgtctggctatcctgggcatccacaacgaggtgtccaagattgtccag
acctaccacgtcaatatggcgggcaccaacccctacacaaccatcacgcctcaggagatc
aatggcaaatgggaccacgtgcggcagctggtgcctcggagggaccaagctctgacggag
gagcacgcccgacagcagcacaatgagaggctacgcaagcagtttggggcacaggccaat
gtcatcgggccctggatccagaccaagatggaggagattgggaggatctccattgagatg
cacgggaccctggaggaccagctcagccacctgcggcagtatgagaagagcattgtcaac
tacaagccaaagattgatcagctggagggcgaccaccagctcatccaggaggcgctcatc
ttcgacaacaagcacaccaactacaccatggagcacatccgtgtgggctgggagcagctg
ctcaccaccatcgccaggaccatcaacgaggtggagaaccagatcctgacccgggatgcc
aagggcattagccaggagcagatgaatgagttccgggcctccttcaaccactttgaccgg
gatcactccggcacactgggtcccgaggagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagaagaagacaggcatgatggacacggatgatttccgcgcc
tgcctgatctccatgggttacaacatgggagaagcagaatttgcccgcatcatgagcatt
gtggaccccaaccgcctgggggtagtgacattccaggccttcattgacttcatgtcccgt
gagacagccgatacagatacagcagaccaagtcatggcttccttcaagatcctggctggg
gacaagaactacattaccgtggacgagctgcgccgcgagctgccgcctgaccaggccgag
tactgcatcgcgcggatggccccctacaccggccccgactccgtgccaggtgctctggac
tacatgtccttctccacggcactgtacggcgagagtgacctctaa

DBGET integrated database retrieval system