KEGG   Macaca mulatta (rhesus monkey): 695126
Entry
695126            CDS       T01028                                 

Gene name
DGKK
Definition
(RefSeq) diacylglycerol kinase kappa isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    695126 (DGKK)
   00564 Glycerophospholipid metabolism
    695126 (DGKK)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    695126 (DGKK)
   04072 Phospholipase D signaling pathway
    695126 (DGKK)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    695126 (DGKK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     695126 (DGKK)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat PH C1_1 Prok-RING_1 PH_3 C1_2
Other DBs
NCBI-GeneID: 695126
NCBI-ProteinID: XP_014982906
Ensembl: ENSMMUG00000016492
UniProt: A0A1D5R8J9
LinkDB
Position
X
AA seq 1265 aa
MDRGAAAAQGTAPPQDGEQPAESSEPPPPWPPPPPPPAPPPAPPLLSEPSPEPVPEPCPE
PAPGPCPEATSEPATELYTEPTPEPATEPAPEPATEPAPEPATEPAPEPAPEPAIEPAPE
PTPEPAPESVPEQAPELTPEVAPEAAPEPTPEPVTELAPEFCPEAPPESRPSPAPCLLQC
PVDIRERGLKTSPSPLPSPRTPMSWSRIKKILKEGPMLKNCNSFKRWKLRYFLVQGQKLY
FAHHPAFAHFETIDLSQAAVAETSCRNLCHSFCVITPQRKITLAAPNRKDMEEWINIIKT
VQQGEIYKIPAAENNPFLVGMHYWYSSYSHRTQHCNVCRESIPALSRDAIICEVCKVKSH
RLCALRASKDCKWNTLSITDDLLLPADEVNMPHQWVEGNMPVSSQCAVCHESCGSYQRLQ
DFRCLWCNSTVHDDCRRRFSKECCFGSHRSSVIPPTALSDPKGDGQLVVSSDFWNLDWSS
ACSCPLLIFINSKSGDHQGIIFLRKFKQYLNPSQVFDLLKGGPEAGLSMFKNFARFRILV
CGGDGSVSWVLSLIDAFGLHDKCQLAVIPLGTGNDLARVLGWGAFWNKSKSPLDILNRVE
QASVRILDRWSVMIRETPRQTPLLKGQVEMDVPRFEAAAIQHLESAATELNKILKAKYPT
EMIIATRFLCSAVEDFVIDIVKAWGQIKQNNTAIVSVILKSDLMYDKLSVLIDVLAEEAA
ATSAEKSATVYADSSKADRKPFVLQIDHIAKCKLELATKAQNLQKSLKLIIFQVEQVLDE
ESRQTISVKNFSSTFFLEDDPEDINQTSPRRRSRRGTLSAISSLKSEDLDNLNLDHLYFT
PESIRFKEKCVMNNYFGIGLDAKISLDFNTRRDEHPGQYNSRLKNKMWYGLLGTKELLQR
SYRKLEERVHLECDGETISLPNLQGIVVLNITSYAGGINFWGSNTATTEYEAPAIDDGKL
EVVAIFGSVQMAMSRIVNLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPGLIKIRY
KNSAQMLTRDRDFENSMKMWEYKHTEIQAAPQPQLDSQDSQENLSDEEYAQMQHLARLAE
NLISKLNDLSKVHQHVSVLMDSVNASADILNDIFYGQDSGNEMGAASCIPIETLSRNDAV
DVTFSLKGLYDDTTAFLDEKLLRSAEDETALQSALDAMNKEFKKLSEIDWMNSIFVPEEK
SSDTDSRSLRLKIKFPKLGKKKLEEEHKPKSGQGAQSFIGSLWHRRHCEDEAKGDDPLTP
SRSQL
NT seq 3798 nt   +upstreamnt  +downstreamnt
atggaccgcggagctgccgcggcccagggcactgccccgcctcaggatggagagcagccc
gctgagtcttcagagcctccgccgccttggccgccgccgccaccaccaccggctccgccg
ccggctccaccactgctctccgagccttcgccagaacccgtaccagagccctgtccagag
cctgctccaggaccctgtccggaggcgacctcagaaccagccacagaactgtacacagaa
ccgaccccagaaccagccacagagccggcgccagaacctgccacagagccggcgccagaa
cctgccacagagccggccccagaaccggccccagaacctgccatagagcctgccccagag
ccgactccagaacctgccccagagtcggtcccagagcaggccccagagctgactccagaa
gttgccccagaggcggccccagagccgaccccagaacctgtgacagagctggccccagag
ttctgccctgaggcgcctccagagtcccgtccgagtccagcaccatgtctattgcaatgt
ccggtggacattcgagagaggggtctaaagacctcgccatcgccattgccatcgcccaga
acgccaatgtcgtggtccagaataaagaaaatattgaaggaaggacctatgctgaagaac
tgtaactccttcaagagatggaagcttagatattttctggttcaaggacagaagctctac
tttgcacaccatcccgcgtttgcacactttgaaacgattgatctgtctcaagccgctgtg
gcagaaaccagctgtagaaacctttgccacagtttttgtgttatcacaccacaacgaaaa
atcactctggctgcacccaaccggaaagacatggaagaatggattaacatcataaaaacc
gtccaacagggagaaatttataagatacctgcagcagaaaataacccttttcttgttgga
atgcactattggtactccagctacagccaccggactcagcactgcaatgtttgtcgagag
agcattcctgccttatccagagatgccatcatctgtgaagtgtgcaaagtgaaatctcac
agattatgtgctttgagagcaagcaaagactgcaagtggaatacattgtctatcactgat
gacctcctcctgcctgcagatgaagtaaacatgccccatcagtgggtagaaggaaacatg
cctgttagctctcagtgtgcagtatgtcatgagagctgtggcagttatcaaagacttcaa
gacttccgctgcctgtggtgtaattctacggtgcatgatgactgtaggagacggttttcc
aaggaatgttgcttcggaagccatcgctcatcagtcattcctcccacggctctaagcgac
cccaaaggcgatggccaattagtagtatcttcggacttctggaatcttgattggtcatca
gcctgttcatgtcccttgctcatcttcatcaactccaaaagtggcgatcatcaggggatc
atcttcctccgaaaattcaagcaataccttaacccatctcaagtgttcgacctattgaag
ggtggacctgaagcagggctgtctatgttcaagaactttgctcgctttcgcattctggtt
tgtggtggagatggcagcgtgagctgggtcttatctctgattgatgcctttggattacat
gacaagtgtcagctggcagtcatcccacttggaaccggcaatgatctggctcgtgtcctg
ggctggggtgcattctggaacaaaagcaagtcacctctggacatcctcaacagagtggag
caggctagtgtgaggatcctagacagatggagtgtgatgattcgtgagactcccagacaa
accccactgctaaaaggacaggttgaaatggatgtaccacgatttgaggctgctgccatc
caacacttagaatctgcagccaccgagttgaacaaaatcctgaaggccaagtaccccaca
gagatgatcatcgcaaccagattcctgtgttcagccgtggaagattttgtgattgatatt
gtaaaggcctggggtcagataaaacagaacaatacagcaatagtgtctgtgattttgaaa
agtgacttaatgtatgataagctcagtgtcctgatcgatgtcctggctgaggaggcagca
gctacttctgctgagaaaagtgctacagtatatgcagacagcagcaaggcagataggaag
cccttcgttcttcaaatagaccacatagccaagtgcaagttggagctggccacaaaggcc
cagaatctccagaaatccttgaaactcatcatattccaagttgaacaagttctggatgag
gaaagcagacagacaatatctgttaagaactttagttcaactttcttcctggaagatgac
ccagaagatattaaccagacaagcccacgacgccgttctcgtcgtggcactttgtctgct
atatcttctctcaaaagtgaggacctagacaaccttaacttggatcacttatattttaca
cctgaatctatacgcttcaaagaaaaatgtgtcatgaacaactacttcggaattggactg
gatgctaaaatttctctggacttcaacaccagaagagatgaacacccggggcaatacaat
agccgccttaagaacaagatgtggtatggccttctgggaaccaaggaacttttgcagcgc
tcttacaggaaactggaagaacgagtgcatttggagtgtgatggagaaaccatctccttg
ccaaacctgcaaggcatcgtagtgctcaacattaccagctatgccggaggtatcaacttc
tggggaagcaacacagcaaccacggaatatgaggctcctgcaatcgatgatgggaagctg
gaggtggtggcaatatttggctctgtgcagatggcaatgtcccgtatcgtcaacctgcat
catcatcgcattgcccagtgccatgaggtgatgataaccattgatggtgaagaaggtatc
ccagtgcaggtggatggggaggcctggattcagagaccaggccttatcaagattagatat
aagaattctgctcagatgctgacaagagatcgggactttgagaactcaatgaaaatgtgg
gagtacaagcatactgaaattcaagctgcccctcaaccccaactggattcccaggactct
caagagaacctctctgatgaggagtatgcccagatgcagcacttagctcggcttgcagaa
aacctcatcagcaaacttaatgacctgagcaaggtccaccagcatgtgtctgtcctcatg
gattctgtgaatgccagcgctgacatcctgaatgatatattttatggccaagacagtggc
aatgagatgggtgcagcttcctgtattcccattgaaactctaagcagaaatgatgctgta
gatgttacatttagtcttaaagggctctacgatgacaccacagctttcctggatgaaaag
ctgctgagaagtgctgaggatgagacggcactacaaagcgccctggatgccatgaataag
gagttcaaaaaactatctgagattgactggatgaattcaatctttgttccagaggaaaaa
tcttcggacactgacagtagaagtctcaggctgaaaattaagttccccaaattgggaaag
aaaaagctagaagaggaacacaagcctaaatcaggccagggtgcccagagttttattgga
agtctgtggcaccgcagacattgtgaagatgaagcaaagggcgatgatcctctaacacca
tcaagatctcaactgtag

KEGG   Macaca mulatta (rhesus monkey): 696414
Entry
696414            CDS       T01028                                 

Gene name
DGKQ
Definition
(RefSeq) diacylglycerol kinase theta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    696414 (DGKQ)
   00564 Glycerophospholipid metabolism
    696414 (DGKQ)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    696414 (DGKQ)
   04072 Phospholipase D signaling pathway
    696414 (DGKQ)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    696414 (DGKQ)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     696414 (DGKQ)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 RA C1_2
Other DBs
NCBI-GeneID: 696414
NCBI-ProteinID: XP_014993286
LinkDB
Position
5
AA seq 953 aa
MAAAAEPGARAWLGGGSPRPGSPACSPVLGAGGRARPGPGPGPGPGPGPGPGPGPGPERA
GARAPGSVAGPGHSFRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKLVRIPC
TSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDC
RQCHQDGHQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSA
VLAPECGFGRLRSLVLPPACVRLLPGGFSKTQSFRIAEAVEPGEGGDGADGSAAVGPGRE
TPATPESGKQTLKIFDGDDAVRRSQFRLITVSRLASAEEVLEAALRVHHIPEDPGHLELC
PLPPSLKACDTWAGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKV
GVAYVSVRVTPKSTARSVVLEVLPLLGRQAEGPESFQLVEVAMGCRQVQRTALMDEQPLL
DRLQDIRQMSVRQVSQTRFYVAESGDVAPHVSLFVGGLPPGLSPEEYSSLLHEAVATKAT
VVSVSHVYSSQGAVVLDVTCFSEAERLYVLLKDMAVRGRLLTALVLPDLLHAKLPPDSCP
LLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDG
TVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPLSVLLSVDEAD
AVLMDRWTILLDAHDTASAENGTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGK
FTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADL
WGSDSDTRFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQ
VDGEPWVQAPGHMIISAAGPKVHMLRKAKQKPRRAGTTRDARADAPAPEGDPR
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggcggcggcggccgagcccggggcccgtgcctggctgggcggcggctccccgcgcccc
ggcagcccggcctgcagccccgtgctgggcgcaggaggccgcgcgcgcccggggccggga
cccgggccggggccggggccgggacccgggccggggccggggccggggccggagcgggcg
ggcgccagagccccgggctccgttgccgggccgggacacagcttccggaaggtgacgctc
accaagcccaccttctgccacctctgctccgacttcatctgggggctggccggcttcctg
tgcgacgtctgcaatttcatgtcccatgagaagtgcctgaagcttgtgaggatcccgtgc
acgagtgtggcgcccagcctggtccgggttcccgtggcccactgcttcggcccccggggg
ctccacaagcgcaagttctgtgctgtctgccgcaaagtcctggaggcgcctgcactccac
tgcgaagtgtgtgagctgcacctccacccagactgtgtgcccttcgcctgcagtgactgc
cgccagtgccaccaggatgggcaccaggatcacgacacccatcaccaccactggcgggag
gggaacctgccctcaggagcgcgctgcgaggtctgcaggaagacgtgcggctcctctgac
gtgctggccggagtgcgctgcgagtggtgcggggtccaggcgcactccgtctgctccgcg
gtgctggctcccgagtgcggcttcgggcgtctgcgctccctggtcctgcccccggcatgc
gtgcgcctcctgcccggtggcttcagcaagacgcagagcttccgcatcgcggaggcggtg
gagccgggcgagggaggcgatggcgcggacgggagcgctgccgtgggtccaggcagagag
acaccggcgactccggagtccgggaagcaaacgctgaaaatctttgatggtgacgacgcg
gtgaggagaagccagttccgcctcatcacggtgtcccgcctggccagtgccgaggaggtg
ctggaggccgcgcttcgggtccaccacatccccgaggaccctggccacctggagctgtgc
ccgctgcccccttccttgaaggcctgtgacacctgggctgggggcaaggctgggagtgct
gtgatttcggaggagggcagaagccctgggtctggcgaggccacaccagaggcctgggtc
atccgggctctgccgcgggcccaggaggtcctgaagatctaccctggctggctcaaggtg
ggcgtggcctatgtatccgtgcgagtgaccccgaagagcacggcccgctccgtggtgctg
gaggtcctgccactgctcggccgccaggccgagggtcctgagagcttccagctggtggag
gtggcgatgggctgcaggcaggtccagcggacagcgctgatggacgaacagccgttgctg
gaccggctacaggacatccggcagatgtccgtgcgacaggtgagccagacgcggttctac
gtggcagagagcggggatgtagccccgcacgtctccctgtttgttggcggcctgcctccc
ggcctgtcccccgaggagtacagcagcctgctgcatgaggccgtggctaccaaagccacc
gtggtgtctgtgagtcacgtctactcctcccaaggcgcagtagtgctggatgtcacctgc
ttttcggaggccgagcggctgtacgtgctgctcaaggacatggctgtgcggggccggctg
ctcactgcactggtgctccccgacctgctgcacgcgaaactgcccccagacagctgtccc
ctccttgtgttcgtgaaccccaagagtggaggcctcaagggccgagacctgctctgcagc
ttccggaagctactgaaccctcaccaggtcttcgacctgaccaacgggggtccccttcct
gggctccacctgttctcccaggtgccctgcttccgggtgctggtgtgcggtggcgacggc
actgtgggctgggtgctcggcgccctggaggagacgcggtaccgactggcctgcccggag
ccttctgtggccatcctgcccctgggcacagggaatgaccttggccgagtcctccgctgg
ggggcaggctacagcggcgaggacccgctctccgtgctgctgtccgtggatgaggccgac
gccgtgctcatggaccgctggaccatcctgctggacgcccatgatactgccagtgcagag
aatggcactgcagacgcagagccccccaagatcgtgcagatgagtaactactgtggcatt
ggcatcgatgcggagctgagcctggacttccaccaggcacgggaagaggagcctggcaag
ttcacaagcaggctgcacaacaagggtgtgtacgtgcgggtggggctgcagaagatcagt
cactctcggagcctgcacaagcagatccggctgcaggtggagcggcaggaggtggagctg
cccagtatcgaaggcctgatcttcatcaacattcccagctggggttccggggccgacctg
tggggctcagacagcgacaccaggtttgagaagccgcgcatggatgatgggctgctggag
gtggtgggcgtgacgggcgtcgtgcacatgggccaggtccagggtgggctgcgctccggg
atccggattgcccagggttcctacttccgggtcacactcctcaaggccaccccggtgcag
gtggacggggagccctgggtccaggccccggggcacatgatcatctcagctgctggccct
aaggtccacatgctgaggaaggccaagcagaagccgaggagagccgggaccaccagggac
gcccgggcggatgcgcctgcccctgagggcgatcctaggtag

KEGG   Macaca mulatta (rhesus monkey): 699337
Entry
699337            CDS       T01028                                 

Gene name
DGKH
Definition
(RefSeq) diacylglycerol kinase eta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    699337 (DGKH)
   00564 Glycerophospholipid metabolism
    699337 (DGKH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    699337 (DGKH)
   04072 Phospholipase D signaling pathway
    699337 (DGKH)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    699337 (DGKH)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     699337 (DGKH)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 PH SAM_1 PH_8 C1_2 PH_11 SAM_PNT
Other DBs
NCBI-GeneID: 699337
NCBI-ProteinID: XP_014976458
Ensembl: ENSMMUG00000023076
LinkDB
Position
17
AA seq 1220 aa
MAGAGGQHHPPGAAGGAAAAAGAAVPSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGPLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLV
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
TDESKEEAKDDGSKESLTVKTAPRSPDARASHGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
VKRILQGIKELGRSTPQSEV
NT seq 3663 nt   +upstreamnt  +downstreamnt
atggcaggggccggaggccagcaccaccctccgggcgccgctggaggagcggccgccgca
gccggcgccgcggtcccctcagctgctgcctcagcggggccgggagaggattcgtctgac
agcgaagcggagcaagagggaccccagaaactgatccgcaaagtgtccacctccgggcag
atccggaccaagaccagtattaaagagggaccgctattgaagcaaaccagttctttccaa
aggtggaaaaagcgatacttcaaacttcgaggccgcaccctctactatgcaaaggactca
aagtctctgatatttgatgaagttgacctctcagatgctagtgtagctgaagcaagcacg
aaaaatgctaacaacagcttcacgatcatcactccattcagaaggctaatgctgtgtgct
gagaacagaaaggagatggaggattggatcagctcgctgaagtctgtacagaccagagaa
ccctacgaggtggcccagtttaatgtggaacatttctcagggatgcacaactggtacgcc
tgctcccacgcccggcccaccttctgtaacgtgtgcagagagagtctttctggagtcacc
tcccatggcctgtcctgcgaagtgtgtaaattcaaggctcacaaaagatgtgcagtgaga
gcaacaaataactgtaaatggactaccctggcctccattgggaaggacattatagaagat
gaagatggcgtggcgatgcctcaccagtggctcgagggcaacctgcctgtgagtgccaag
tgtgctgtctgtgacaaaacgtgtggcagtgttctccgtctacaggattggaaatgcctg
tggtgtaagacaatggtacacactgcctgcaaagatttataccatccaatatgtccactt
ggtcaatgtaaagtatctatcatacctccaattgcgctaaacagcactgattccgatggt
ttctgtagagcaacattttcgttctgtgttagtcctctattggtttttgtcaattctaag
agtggagataatcagggagtaaagttccttcgtcgctttaaacagttgctaaatccggct
caggtgtttgatttaatgaatggaggtcctcatttaggtttaagattatttcagaagttt
gacaatttccggattcttgtttgtggaggcgatggaagtgtaggttgggttttgtcagaa
atcgataagctcaacttgaataaacagtgtcagctgggagtgttgcctttgggtacagga
aatgaccttgctcgagttcttggctggggaggttcatatgacgacgacacccagcttcct
cagatcctagagaaactggaacgagccagtaccaaaatgttggacaggtggagtataatg
acatatgaactcaaattgccaccaaaagcttccctacttccaggacctccagaagcatct
gaagaattttatatgacgatttatgaagactcagttgcaacgcatcttacgaaaatcctg
aattctgatgaacatgcagtggtcatatcatctgccaagacactatgtgaaactgtaaag
gacttcgttgccaaagtagagaagacatatgacaaaaccttggaaaatgccgttgtagct
gatgccgtagccagtaaatgttcagtcctgaacgagaagctcgaacaactgctgcaggct
ttgcacacagattcccaggctgcacctgttctccctggcctcagccctctcattgtggag
gaagatgctgtggaatcgtccagtgaagagtccctgggtgaaagcaaagaacagctcgtg
gatgatgttaccaaaccttcttcccagaaagccgtcaaaccaagagaaatcatgttgcgg
gcgaatagtttaaagaaagcagtgaggcaagtcatcgaggaagccggaaaagttatggat
gacccgacagttcacccctgtgaaccagctaatcagtcctctgattatgacagcacagaa
acagatgagtctaaggaggaagccaaagacgatggttccaaagaatcactaactgttaaa
actgcacctcggtctccagatgcccgggcaagtcatggccattcccaaactgattctgtc
cctggtccagctgtggcagccagcaaagaaaacctccctgtgctcaataccagaatcatc
tgcccaggtttaagagcaggactggctgcctctattgctgggagttcaattatcaacaaa
atgttactagcaaacattgatcctttcggtgccacgccgtttattgacccggatccagat
tccgtagatggatattcagaaaaatgtgtcatgaacaattactttgggattggattagat
gcaaaaatttcattagaatttaataataaaagagaggagcaccctgaaaaatgcaggagc
cgaactaaaaacttgatgtggtatggagtgcttggaacccgggagttattacagagatcg
tacaagaatttagaacaaagggttcaacttgagtgtgatgggcaatatattcctcttccc
agcttgcaaggcatagctgtgttgaacattcccagctatgctggaggcactaacttttgg
ggtggaactaaagaggatgatatatttgctgcaccgtcatttgatgacaagatcctggaa
gttgtagcaatatttgatagcatgcaaatggcagtttcaagggtcattaaactgcagcat
catcgaatagcccagtgccgtacagtaaaaatcactatatttggtgacgaaggagtccca
gtgcaagtggatggtgaagcatgggttcagcctccagggattatcaaaattgtgcacaaa
aacagagcacaaatgctaacaagggacagagcctttgagagcactctgaaatcttgggaa
gataagcagaagtgtgattctggtaaaccagttctccgaacccatttgtacatccatcat
gccattgacttagcaacggaagaggtgtcgcagatgcagctgtgctcccaggctgcagag
gagctcattactaggatctgtgacgcagccacaattcattgtcttttggagcaagaactg
gcccatgctgtgaatgcctgctctcatgccctgaataaagccaacccaaggtgcccggag
agtcttacaagagacactgccactgaaatagccatcaatgtgaaggcgctgtataatgaa
acggaatctttgctagttggcagggttcctttgcagctggaatcgccacatgaagagcgg
gtatccaatgccttacactctgtggaggtggaattacagaaattgacagagattccttgg
ctttattatatcttacacccaaatgaggatgaggaacctcctatggattgcaccaaaaga
aacaacagaagcactgtatttcgaatagtgccaaagtttaaaaaggaaaaggttcagaag
cagaagacaagttcacagcctgttcagaaatggggcacagaggaagttgctgcttggctg
gatctgctcaatttgggagagtacaaagatatcttcatccgtcatgacatcagaggggct
gaacttttgcatctggaaaggcgagatcttaaggacctggggataccgaaggtgggccat
gtgaagcgaattctccagggaattaaagagcttggaaggagcactccacagtcagaggtg
taa

KEGG   Macaca mulatta (rhesus monkey): 699967
Entry
699967            CDS       T01028                                 

Gene name
DGKG
Definition
(RefSeq) diacylglycerol kinase gamma isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    699967 (DGKG)
   00564 Glycerophospholipid metabolism
    699967 (DGKG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    699967 (DGKG)
   04072 Phospholipase D signaling pathway
    699967 (DGKG)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    699967 (DGKG)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     699967 (DGKG)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 699967
NCBI-ProteinID: XP_014986894
Ensembl: ENSMMUG00000021972
UniProt: F6RTS2
LinkDB
Position
2
AA seq 791 aa
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDVLTEFNEGGSLKQYDPHEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRQETSDHPTEEASNSEANSPDTNIQNAENATKADEAC
APDTESNMAEMQAPTEDQVAATPPEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSKNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELATLCDGGELRDHILLPTSICPITRDRPGGKSDGCVSAKGEL
VLQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFH
DTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL
TKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMRE
KHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNI
PSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCIQDLSDQLLEVVGLEGAMEMGQIY
TGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSF
FSLRRKSRSKD
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgggtgaagaacggtgggtctccctcactccggaagaatttgaccagctgcagaaatat
tcagaatattcctccaagaagataaaagatgtcttgactgaatttaatgagggtgggagc
ctcaaacaatatgacccacatgagccaattagctatgatgtcttcaagctgttcatgagg
gcatacctggaggtggaccttccccagccactgagcactcacctcttcctggccttcagc
cagaagcccagacaggagacctctgaccacccgacggaggaggccagcaacagcgaggcc
aatagcccagatactaatatacagaatgcagagaatgccaccaaagcagatgaggcctgt
gcccctgatactgaatcaaatatggctgagatgcaagcaccaactgaagaccaagtggct
gcaacccccccggaaccccccgtccctcggtcttcaagctcggaatcccctgtggtgtac
ctgaaggatgttgtgtgctacctgtccctgctggagacgggaaggcctcaggataagctg
gagttcatgtttcgcctctatgattcagatgagaacggtcttctggaccaagcggagatg
gattgcattgtcaaccaaatgctgcatattgcccagtacctggagtgggatcccacagag
ctgaggcctatattgaaggagatgctgcaagggatggactacgaccgggatggctttgtg
tctctacaggaatgggtccatggagggatgaccaccatcccattgctggtcctcctgggg
atggatgactctggctccaaaggggatgggcggcacgcctggaccatgaagcacttcaag
aaaccaacctactgcaacttctgccatattatgctcatgggcgtccgcaagcaaggcctg
tgctgcacttactgtaaatacactgtccacgaacgctgtgtgtccaaaaacattcctggt
tgtgtcaaaacgtactcaaaagccaaaaggagcggcgaggtgatgcagcacgcatgggtg
gaagggaactcctccgtcaagtgtgaccggtgccacaaaagtatcaagtgctaccagagt
gtcaccgcgcggcactgcgtgtggtgccggatgacgtttcaccgcaaatgtgaattagca
acgttgtgtgacggtggggaactcagagaccacatcttgctgcccacctccatatgcccc
atcacccgggacaggccaggtgggaagtctgatggctgcgtatccgccaagggtgaactt
gtcctgcagtataagatcatccccaccccgggtacccaccccctgctggtcttggtgaac
cccaagagtggagggagacaaggagaaagaattcttcggaaattccactatctgctcaac
cccaaacaagttttcaacctggacaatggggggcctactccagggttgaattttttccat
gatactccagacttccgtgttttggcctgtggtggagatgggacagttggctggattttg
gattgcattgataaggccaactttgcaaagcatccaccagtggctgtcctgcctcttgga
acaggaaatgaccttgcccgctgtctccgctggggaggaggttatgaagggggcagcttg
acaaaaatcctgaaggacattgagcagagccccttggtgatgctggaccgctggcatctg
gaagtcatccccagagaggaagtggaaaacggggaccaggtcccatacagcatcatgaac
aactatttctccattggtgtggacgcttccattgcacacagattccacgtgatgagagag
aaacaccctgaaaaattcaacagcaggatgaagaacaagctctggtactttgaatttggt
acctcggagacttttgcagcgacctgcaagaaactgcatgaccacattgagttggagtgt
gatggggttggggtggacctgagcaacatcttcctggaaggcattgccattctcaacatt
cccagcatgtacggaggcaccaatctctggggagaaaacaagaagaaccgggccgtgatc
cgggaaagcaggaagggtgtcactgaccccaaagaactgaaattctgcattcaagacctc
agtgaccaactccttgaagtggtggggctagaaggagccatggagatggggcagatctac
accggcctgaagagtgcaggcaggaggctggcccagtgctcctctgtcaccatcaggaca
aacaagctgctgccaatgcaagtggatggagaaccctggatgcagccatgttgcacgatt
aaaattactcacaagaaccaagcgcccatgatgatggggcctccccagaagagcagcttc
ttctcgttgaggaggaagagccgttcaaaagactaa

KEGG   Macaca mulatta (rhesus monkey): 709578
Entry
709578            CDS       T01028                                 

Gene name
DGKI
Definition
(RefSeq) diacylglycerol kinase iota isoform X15
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    709578 (DGKI)
   00564 Glycerophospholipid metabolism
    709578 (DGKI)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    709578 (DGKI)
   04072 Phospholipase D signaling pathway
    709578 (DGKI)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    709578 (DGKI)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     709578 (DGKI)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_3 Ank_5 Ank_4 Ank
Other DBs
NCBI-GeneID: 709578
NCBI-ProteinID: XP_014990472
Ensembl: ENSMMUG00000016831
LinkDB
Position
3
AA seq 1059 aa
MDAAGRGCHLLPLPAARGPARAPAAAAAAASAASPPGLCSGAACAPSAAAGVGAMNPSSS
AGEEKGATGGSSSSGSGAGSCCLGAEGGADPRGAGAAAAAGAAALDEPAAAGQKEKDEAL
EEKLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEH
LWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFRE
GGSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVT
CFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQE
NKGRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDAL
ELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYT
DEPVSKILCQVEDGTIVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAH
VTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQ
ELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHG
ERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQ
SVPDRLRIRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDL
QSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDATSADRFYRIDRSQEHLHFVMEIS
QDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGMIAPYYE
DSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYA
AKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDS
KGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV
NT seq 3180 nt   +upstreamnt  +downstreamnt
atggatgctgcgggaaggggctgccatttgctgcccctgccagcggcgcgcggacctgcc
cgcgctcctgcagccgccgccgccgccgccagcgccgccagcccgcccggcctctgcagc
ggggccgcctgcgctccctccgcggccgccggagtgggcgccatgaaccccagctcctcg
gcgggagaggagaagggggcgacgggcggcagcagcagcagcggaagcggcgccgggagc
tgctgcctgggcgccgagggcggcgcggacccgcggggcgcaggggcagccgcggcggcg
ggggccgctgccctggacgagcccgcggccgccggccagaaggagaaggacgaggcgctg
gaggagaagctgaggaacttaactttccggaagcaggtctcgtacaggaaagcaatctcc
cgggcaggcctccagcatctggctcctgcacatcccctcagccttcctgtggcaaatggt
ccagccaaggagcccagagcgactttggactggagtgagaatgccgtgaatggagaacac
ctgtggctggagacgaacgtctcgggagacctatgctaccttggagaggagaactgccaa
gtcagatttgcaaaatcagctctcaggaggaagtgtgcagtctgtaaaatcgtcgtccac
accgcctgcattgagcagctagaaaagattaatttcagatgtaaaccaacatttcgagaa
ggaggctcaaggtcaccaagagaaaattttgtacgtcatcactgggtgcacaggcgtcgg
caggaggggaaatgtaagcagtgtggtaagggcttccagcaaaagttctccttccacagt
aaagagattgtggctatcagctgttcctggtgcaagcaggcgtttcacaataaggtgacc
tgcttcatgctgcatcacattgaagaaccctgctccctgggggctcatgctgctgttatt
gtcccacccacttggatcattaaggtgaagaaacctcagaactcactgaaggcttcaaat
cggaagaagaagagaacaagctttaaaagaaaagccagtaaaagagggatggaacaggaa
aacaaaggtcgtccttttgtgataaaacccatctcttctcctctcatgaaacccttgctt
gtatttgtgaatcccaagagtggaggcaaccagggaaccaaagtcctgcagatgttcatg
tggtacctgaatccacggcaagtctttgatctttctcaggaagggccaaaagatgcgctt
gaattgtataggaaagtaccaaatctgcgaattctggcctgtggtggggatggaacggtg
ggctggatcctttctatcctggatgaactgcagctgagccctcagcctcccgtgggggtc
cttcctctggggactgggaatgacctggctcgaactctcaactggggagggggctacact
gatgagcctgtttctaagatcctgtgccaagtggaagatgggacaattgtacagctagat
cgctggaacctccatgtggaaagaaaccccgacttgcctccagaagaacttgaagatggc
gtatgtaagctccctctgaatgttttcaataactacttcagccttggatttgatgctcat
gtcacactggagttccatgaatccagagaagcaaatccagagaaattcaacagtcgtttt
cgaaataaaatgttctatgcaggggcagctttttctgacttcctacagagaagttctaga
gatctgtccaaacatgttaaagttgtttgtgatggaacagatctcaccccaaagattcag
gaactgaagttccagtgtatagtatttttaaatatacccagatattgtgctggcacaatg
ccctggggaaacccaggagatcaccacgatttcgaacctcagcgtcatgatgatggttat
attgaagtcattggatttaccatggcctctttggcagccttgcaagttgggggccatgga
gagaggctacaccagtgtcgagaagtcatgcttctaacttacaaatccatccccatgcaa
gtggatggggagccctgtaggttggccccagctatgattcggatctccctgaggaatcag
gccaacatggtacagaagagcaagaggagaacatccatgcctttacttaatgatccccag
tctgtcccagatcgtctgaggatccgggtgaacaaaatcagtttgcaagactatgaagga
ttccactatgacaaggagaaactccgggaagcttcaatacctctgggtattctagttgtg
cgtggagactgtgatttggagacttgccgtatgtacatagaccgcctacaggaggaccta
cagtcagtttcttctggctcccagagagttcattaccaggaccatgaaacctccttcccc
agggctctctcagcacagaggctctcccctcggtggtgcttcctagatgcaacttctgct
gatcgcttttatcgaatagacagatctcaggaacatttgcactttgtgatggagatttcc
caagatgagatttttattctggacccagatatggtggtgtcacagccagcggggacacct
ccgggcatgcctgacctggtggtggagcaagcctcggggatctcagactggtggaatcct
gccctgcggaaacgcatgctgagtgacagtgggctggggatgatagctccctattatgag
gactcagatctgaaagatctcagccactcccgcgtgctacagtcaccagtctcttcagaa
gatcatgcaattttgcaggcagtaatagctggtgatcttatgaagctaatagaaagctat
aaaaatggaggcagtctgctaattcagggaccagaccactgttcactccttcactacgca
gctaaaaccggcaacggggagattgtgaaatatatccttgaccacggaccttccgagtta
ttggatatggcagacagtgaaacgggtgagactgcactgcacaaggctgcctgccagcgg
aaccgggctgtgtgccagcttctggtggatgcaggagcatctctgagaaagacggactcc
aagggtaagacacctcaagagagagcacagcaggctggggacccagacttggctgcttac
ctagaaagccgtcagaactataaggtcattggccatgaggacctggaaactgctgtttga

KEGG   Macaca mulatta (rhesus monkey): 710559
Entry
710559            CDS       T01028                                 

Gene name
DGKA
Definition
(RefSeq) diacylglycerol kinase alpha isoform X8
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    710559 (DGKA)
   00564 Glycerophospholipid metabolism
    710559 (DGKA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    710559 (DGKA)
   04072 Phospholipase D signaling pathway
    710559 (DGKA)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    710559 (DGKA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     710559 (DGKA)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 C1_2 EF-hand_8
Other DBs
NCBI-GeneID: 710559
NCBI-ProteinID: XP_001112709
Ensembl: ENSMMUG00000018814
UniProt: G7N7A5 A0A5F8AM07
LinkDB
Position
11
AA seq 735 aa
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFKTDHCLNEANVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDGRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLETSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRKPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggccaaggagaggggcctaataagccccagtgattttgcccagctgcaaaaatacatg
gaatactccaccaaaaaggtcagtgatgtcctaaagctcttcgaggatggtgagatggct
aaatatgtccaaggagatgccattgggtacgagggattccagcaattcctgaaaatctat
ctggaagtggataatgttcccagacacctaagcctggcactgtttcaatcctttaagact
gatcactgcttaaatgaggcaaatgtgacaaaagatgtggtgtgtctcaatgatgtttcc
tgctacttttcccttctggagggtggtcggccagaagacaagttagaattcaccttcaag
ctgtacgacacggacagaaatgggatcctggacagctcagaagtggacaaaattatccta
cagatgatgcgagtggctgaatacctggattgggatgtgtctgagctgaggccgatcctt
caggagatgatgaaagagattgactatgatggtagtggctctgtctctcaagctgagtgg
gtccgggctggggccaccactgtgccactgctagtgctgctgggtctggagatgactctg
aaggacgatggacagcacatgtggaggcctaagaggttccccaggccagtttactgcaat
ctgtgcgagtcaagcattggtcttggcaaacaggggctgagctgtaacctctgtaagtac
actgttcacgaccagtgtgccatgaaagccctgccttgtgaagtcagcacctatgccaag
tctcggaaggacattggtgtccaatcacatgtgtgggtgcgaggaggctgtgagtccggg
cgctgcgaccgctgtcagaaaaagatccggatctaccacagtctaaccgggctgcattgt
gtatggtgccacctagagatccacgatgactgcctgcaagcggtgggccatgagtgtgac
tgtgggctgctccgagatcacatcctgcctccatcttccatctatcctagtgtcctggcc
tctggaccggatcgtaaaaatagcaaaacaagccagaagaccatggatgatttaaatttg
agcacctctgaggctctgcggattgaccctgttcctaacactcacccacttcttgtcttt
gtcaatcctaagagtggcgggaagcaggggcagagggtgctctggaagttccagtatata
ttaaaccctcgacaggtgttcaacctcctgaaggatggtcctgagatagggctccgattg
ttcaaggatgttcctgatggccggattttggtgtgtggtggagatggcacagtaggctgg
attctagagaccattgacaaagctaacttgccggttttgcctcctgttgctgtgttgccc
ctgggtactggaaatgatctggctcgatgcctaagatggggaggaggatatgaaggacag
aatctggcaaagatcctcaaggatttagagacgagtaaagtggtacatatggatcgatgg
tccgtggaggtgatacctcaacaaaccgaagaaaagagtgaccccgtcccctttcaaatc
atcaataactacttctccattggtgtggatgcctctattgctcatcgattccacatcatg
cgagagaaatatcctgagaagttcaacagcagaatgaagaacaagctatggtacttcgaa
tttgccacatctgaatccatcttctcaacatgcaaaaagctggaggagtctttgacagtt
gagatatgtgggaaaccgctggatctgagcaacctgtccctagaaggcatcgcagtgcta
aacatccctagcatgcatggtggctccaacctctggggtgataccaggaaaccccatggg
gatatctatgggatcaaccaggccttaggtgctacagctaaagtcatcaccgaccctgat
atcctgaaaacctgtgtaccagacctaagtgacaagagactggaagtagtcgggctggag
ggtgcaattgagatgggccaaatctataccaagctcaagaatgcgggacgtcggctggcc
aagtgctctgagatcaccttccacaccacaaaaacccttcccatgcaaattgatggagaa
ccctggatgcagacgccctgtacaatcaagatcacccacaagaaccagatgcccatgctc
atgggcccacccccccgctctaccaatttctttggcttcttgagctaa

KEGG   Macaca mulatta (rhesus monkey): 712450
Entry
712450            CDS       T01028                                 

Gene name
DGKE
Definition
(RefSeq) diacylglycerol kinase epsilon isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    712450 (DGKE)
   00564 Glycerophospholipid metabolism
    712450 (DGKE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    712450 (DGKE)
   04072 Phospholipase D signaling pathway
    712450 (DGKE)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    712450 (DGKE)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     712450 (DGKE)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Other DBs
NCBI-GeneID: 712450
NCBI-ProteinID: XP_014974668
Ensembl: ENSMMUG00000005789
UniProt: G7NHQ2 A0A1D5QMM7
LinkDB
Position
16
AA seq 567 aa
MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRLLHRRDIFRKSKH
GWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKADRRFQCKEIMLKNDTKVL
DAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFG
EFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
RILLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEK
YIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYY
NLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQEC
KDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVV
GVYGSFHCAQIQVKLANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHA
MMLYFSGEQTDDDISSTSDQEDIKETE
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggaagcggagaggcggccggcgccgggctcgccctccgagggcctgtttgcggacggg
cacctgatcttgtggacgctgtgctcggtcttgctgccggtgttcatcaccttctggtgt
agcctccagcggtcgcgccggctgctgcaccgcagagacatcttccgcaagagcaagcac
gggtggcgcgacacggacctgttcagccagcccacctactgctgcgtgtgcgcgcagcac
attctgcagggcgctttctgcgactgctgcgggctccgggtggacgagggctgcctcaag
aaggccgacaggcgcttccagtgcaaggagattatgctcaagaatgacaccaaggtcctg
gacgccatgccccaccactggatcaggggcaacgtgcccctgtgcagttactgtatggtt
tgcaagcagcagtgtggctgtcaacccaagctttgcgattacaggtgcatttggtgccag
aagacagtacatgatgagtgcatgaaaaatagtttaaagaatgaaaagtgtgattttgga
gaattcaaaaacctaatcattccaccaagttatttaacctccattaatcagatgcgtaaa
gacaaaaaaacagattatgaagtgctagcctctaagcttggaaagcaatggacaccatta
ataatcctggccaactctcgtagtggaactaatatgggagaaggactgttgggagaattt
aggatcttgttgaatccagtccaggtttttgatgtaactaaaactcctcctatcaaagcc
ctacaactctgtactcttcttccatattattcagctcgagtacttgtttgtggaggggat
gggactgtagggtgggtcctggatgcagttgatgacatgaaaattaagggacaagaaaag
tacattccacaagttgcagtcttgcctctgggaacaggcaacgatctatccaatacattg
ggttggggtacaggttatgctggagaaattccagttgcacaggttttgcgaaatgtaatg
gaagcagatggaattaaactagatcgatggaaagttcaagtaacaaataaaggatactac
aacttaagaaaacccaaggaattcacaatgaacaactatttttctgttggacctgatgct
ctcatggctctcaattttcatgctcatcgtgagaaggcaccatctctgttttctagcaga
attcttaataaggcggtttacttattttatggaaccaaagattgtttagtgcaagaatgt
aaagatttgaataaaaaagttgagctagaactggatggtgagcgagtagcactgcccagc
ttggaaggtattatagttctgaacattggttactggggcggtggctgcagactatgggaa
gggatgggagacgagacttaccctctagccaggcatgacgatggtctactggaagtcgtt
ggagtatatgggtctttccactgtgctcagattcaagtaaaactggcgaatccttttcga
ataggacaggcacatacagtgaggctgattttgaagtgctccatgatgccaatgcaggtg
gatggggagccttgggcccaagggccctgcactgtcaccataactcacaagacacatgca
atgatgttatatttctctggagaacaaacagatgatgacatctctagtacttcggatcaa
gaagatataaaggagactgaatag

KEGG   Macaca mulatta (rhesus monkey): 713198
Entry
713198            CDS       T01028                                 

Gene name
DGKZ
Definition
(RefSeq) diacylglycerol kinase zeta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    713198 (DGKZ)
   00564 Glycerophospholipid metabolism
    713198 (DGKZ)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    713198 (DGKZ)
   04072 Phospholipase D signaling pathway
    713198 (DGKZ)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    713198 (DGKZ)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     713198 (DGKZ)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_5 Ank_3 Ank_4 Ank
Other DBs
NCBI-GeneID: 713198
NCBI-ProteinID: XP_014969868
Ensembl: ENSMMUG00000021446
LinkDB
Position
14
AA seq 1172 aa
MAVRGCSDPSLPRGLLPSSWGRGCEWAPRRRTDHGLVQLLMSPVSVPNSHPPAMETFFRR
HFQWKVPGPGEGQRRPSGVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCLLSCGVRA
RGSSRRRSSTVPPSCNPRFIVDKVPTPQPTTVGAQLLGAPLLLTGLVGMNEEEKGVQEDV
AAGAWSAVQPGTKTPGPSPPQGARPLSSLPRYLRRASSHLLPADAVYDHALWGLHGYYRR
LSQRRPSGQHPGPGGRRASGTTASTVLPTRVRPLSRRRQVALRRKAAGPQAWSALLAKAI
TKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFETNVSGDFCYVGEQYC
VARMLQKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFVRHHWVH
RRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHA
AVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPL
LVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRILACGGDGT
VGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQL
DRWDLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNS
RFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGTDLTPKIQDLKPQCVVFLNIPRYCAG
TMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIP
VQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDY
EALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWC
FLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCS
PTPRSLQGDAAPPEGEELIEAAKRNDFCKLQELHRAGGDLMHRDERSRTLLHHAVSTGSK
DVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQ
RAEKAQDTELAAYLENRQHYQMIQREDQETAV
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggcggtcagaggctgcagtgacccctccctccctcggggcttgcttccctcctcatgg
ggcagaggctgtgaatgggctcccagacgcaggacagaccatggcctggtccagctcctg
atgtctccggtctctgtgcccaacagccacccgcctgccatggagactttctttaggaga
catttccagtggaaggtgccaggccctggagaggggcagcggcggcccagcggtgtgggg
ctgcccacgggcaaggcccggcgtcgctcccccgctgggcaggcctcctcctcactggca
cagcggcgccgctccagcgcccagctccagggctgcctcctgagctgcggggtgagggcc
cggggttccagccgccggcgctccagcactgtgcccccttcctgcaacccccgtttcatc
gtggataaggtgcccactccacagcctaccactgtgggggcccagcttcttggcgcaccc
ctgctgttgaccgggcttgtgggcatgaatgaggaggagaagggtgtccaggaggatgtg
gcagccggggcgtggagcgccgtccagccaggcaccaagacaccagggccatccccaccc
cagggcgccaggccgctgtcttccctgccccgctacctgcgccgagcctcctcccacctg
ctccctgcggatgctgtgtatgaccacgctctctggggcctgcacggctactatcggcgc
ctcagccagcggcggccctcaggccagcaccctggccctgggggccgaagagcctcaggc
accaccgccagcaccgtgctgcccacccgtgtgcgcccactgtcccgcaggcgccaggta
gccctacggcgcaaggcggcgggaccccaggcctggagcgccctgctcgcgaaagccatc
accaagtcgggcctccagcacctggccccgcctccgcccacccctggggccccgtgcagc
gagtcagagcggcagatccggagcacagtggactggagcgagtcagcgacatatggggag
cacatctggttcgagaccaacgtgtctggggacttctgctacgttggggagcagtactgt
gtagccaggatgctgcagaagtcagtgtctcgaagaaagtgcgcagcctgcaagattgtg
gtgcacacgccctgcatcgagcagctggagaagataaatttccgctgtaagccgtccttc
cgtgaatcaggctcgaggaacgtgcgcgagccaacctttgtacggcaccactgggtacac
agacgacgccaggacggcaagtgtcggcactgtgggaagggattccagcagaagttcacc
ttccacagcaaggagattgtggccatcagctgctcatggtgcaagcaggcataccacagc
aaggtctcctgcttcatgctgcagcagattgaggagccgtgctccctgggggtccacgcg
gccgtggtcatcccgcccacctggatcctccgtgcacggaggccccagaataccctgaaa
gcaagcaagaagaagaagagggcatccttcaagaggaagtccagcaagaaagggcctgag
gagggccgctggagacccttcatcatcagacccaccccctccccgctcatgaagcccctg
ctggtgtttgtgaaccccaagagtgggggcaaccagggtgcgaagatcatccagtccttc
ctctggtatctcaatccccgacaagtcttcgacctgagccagggagggcccagggaggcg
ctggagatgtaccgcaaagtgcacaacctgcggatcctggcgtgcgggggcgacggcacg
gtgggctggatcctctccaccctggaccagctacgcctgaagccgccgccccctgttgcc
atcctgcccctgggtactggcaacgacttggcccgaaccctcaactggggtgggggctac
acagatgagcctgtgtccaagatcctctcccacgtggaggaggggaacgtggtacagctg
gaccgctgggacctccacgctgagcccaaccccgaggcagggcctgaggaccgagatgaa
ggtgccaccgaccggttgcccctggatgtcttcaacaactacttcagcctgggctttgac
gcccatgtcaccctggagttccacgagtctcgagaggccaacccagagaaattcaacagc
cgctttcggaataagatgttctacgctgggacagccttctccgacttcctgatgggcagc
tccaaggacctggccaagcacatccgagtggtgtgtgatggaacagacttgactcctaag
atccaggacctgaaaccccagtgtgttgttttcctgaacatccccaggtactgtgcaggc
accatgccctggggccaccctggggagcaccacgactttgagccccagcggcatgacgac
ggctacctcgaggtcattggcttcaccatgacgtccttggccgcgctgcaggtgggcggg
cacggcgagcggctgacgcagtgccgtgaggtggtgctcaccacgtccaaggccatcccg
gtgcaggtggacggcgagccctgcaagcttgcagcctcacgcatccgcatcgccctgcgc
aaccaggccaccatggtgcagaaagccaagcggcggagcgccgcccccctgcacagcgac
cagcagccggtgcccgagcagctgcgcatccaggtgagtcgcgtcagcatgcacgactac
gaggccttgcactacgacaaggagcagctcaaggaggcctccgtgccgctgggcactgtg
gtggtcccaggagacagtgacctagagctctgccgcgcccacatcgagagactgcagcag
gagcccgatggtgctggagccaagtccccgacatgccagaaactgtcccccaagtggtgc
ttcctggacgccaccactgccagccgcttctacaggatcgaccgagcccaggagcacctc
aactatgtgactgagatcgcacaggatgagatttatatcctggaccctgagctgctgggg
gcatcggcgcggcctgacctcccgacccccacttcccctctccccacctcaccctgctca
cccacgccccggtcattgcaaggggatgccgcaccccctgaaggtgaagagctgattgag
gctgccaagaggaacgacttctgtaagctccaggagctgcaccgagctgggggcgacctc
atgcaccgagatgagcggagccgcacgctcctgcaccatgcagtcagcactggcagcaag
gatgtggtccgctacctgctggaccatgcccccccagagatcctcgatgccgtggaggaa
aacggggagacctgtttgcaccaggcagcggccctgggccagcgcaccatctgccactac
atcgtggaggccggggcctcgctcatgaagacagaccagcagggagacactccccggcag
cgggctgagaaggctcaggacaccgagctggccgcctacctggagaaccggcagcactac
cagatgatccagcgggaggaccaggagacggctgtgtag

KEGG   Macaca mulatta (rhesus monkey): 714210
Entry
714210            CDS       T01028                                 

Gene name
DGKD
Definition
(RefSeq) diacylglycerol kinase delta isoform X4
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    714210 (DGKD)
   00564 Glycerophospholipid metabolism
    714210 (DGKD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    714210 (DGKD)
   04072 Phospholipase D signaling pathway
    714210 (DGKD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    714210 (DGKD)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     714210 (DGKD)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 SAM_1 C1_1 PH PH_8 C1_2 PH_11 SBE2 SAM_3 SAM_PNT
Other DBs
NCBI-GeneID: 714210
NCBI-ProteinID: XP_014966855
Ensembl: ENSMMUG00000005646
LinkDB
Position
12
AA seq 1174 aa
MDLRTSWPRTRTTIIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLSD
ASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHF
SGTHNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLAS
IGKDIIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKE
SLLTKCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLR
RFKQLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQ
LGVLPLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQAS
SSTVTEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGK
AYEKTTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGS
GSVCGSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQE
QEGFVLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVLKSPCEKLISKGSLSLGSSA
SLPPQPGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTE
KCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQK
VLLECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFTAPSFDDKILEVVAVFGS
MQMAVSRVIRLQHHRIAQCRTVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLT
RDRAFESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQ
SHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKM
ALQLDPPQKEQLGSALTEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLV
TKFKKEKNNKNKEVHSSLAAPVHLWGTEEVAAWLEHLSLCEYKDIFMRHDIRGSELLHLE
RRDLKDLGVTKVGHMKRILCGIKELSRSAPAAEA
NT seq 3525 nt   +upstreamnt  +downstreamnt
atggatctgaggacaagctggcccaggaccagaactaccatcatcaaagaggggatgctg
accaaacagaacaattccttccagcgatcaaaaaggagatactttaagcttcgagggcga
acgctttactatgccaaaacggcaaagtcaatcatatttgatgaggtggatctgtcagat
gccagcgtggctgaatccagtaccaaaaacgtcaacaacagttttacggtcataactcca
tgcaggaagctcatcttgtgtgctgataacagaaaagaaatggaagattggattgcagca
ttaaagactgtgcagaacagggagcactttgagcccacccagtacagcatggaccacttc
tcagggacgcacaattggtacgcctgttcccacgcgaggccgacctactgcaacgtgtgc
cgtgaggctctgtctggggtcacgtcgcatgggctgtcctgcgaggtgtgcaaatttaag
gcccacaagcgctgtgctgtgcgtgcaacaaataactgcaagtggaccacgctggcctcg
atcgggaaggacatcattgaagatgcagatgggatcgcaatgccccaccagtggttggaa
ggaaacctacctgtgagtgccaagtgcactgtgtgcgacaagacctgtggcagcgtgctg
cgcctgcaggactggcgctgcctctggtgcaaggccatggttcacacatcgtgtaaagaa
tccttgctgaccaagtgcccacttggcctatgcaaagtgtcagtcatcccacccacggct
ctcaacagcatcgactctgatgggttctggaaggccagctgtcctccgtcttgcacaagc
ccactgttggtcttcgtcaattcaaaaagtggggacaaccagggtgtgaagttcctcaga
agattcaaacagctgctaaatcccgcccaggtcttcgacctcatgaacggaggcccacac
ctcggcttacggttattccagaagtttgacacgttccggattctggtttgtggtggggat
ggaagtgttggttgggtcctctctgaaatcgacagcctcaaccttcataaacagtgtcag
ctgggagtgctgccgctcggcacagggaacgacttggcccgagtgctgggctggggctca
gcctgcgatgatgacacccagctcccccagatcttggagaagttggagagagccagcacc
aagatgctggacaggtggagcgtcatggcatacgaggccaagctcccccgacaggcctcc
tcctccaccgtcaccgaagacttcagcgaggattccgaggtacagcaaattctcttctat
gaagactcggttgcagcccacctttctaaaatccttacctcggaccagcactcggtggtc
atctcctcggccaaagtgctctgtgagacggtgaaggacttcgtggcccgggtggggaag
gcctatgagaagacgaccgagagctcggaggagtcagaggtcatggccaagaagtgctct
gtcctgaaagagaagctggattcccttctcaagaccttggacgatgagtcccaggcctcg
tcctctctgcccaacccacccccgaccattgctgaggaggctgaagatggagatgggtcg
ggcagcgtctgtggctccactggggaccgcttggtggcatcagcctgcccggcccggccg
cagatattccggcctcgagaacagctcatgctgagagccaacagcctgaagaaagcgatt
cgtcagatcatagaacacacagaaaaagctgtcgatgagcagaatgcccagacccaggag
caggagggcttcgtcctgggcctctctgagtcagaggagaagatggaccacagagtgtgc
ccaccactgtcccacagcgagagcttcggggtccccaaggggaggagccagcgcaaagtg
ttgaaatctccgtgtgaaaagctgatcagcaaaggaagtctgtccctgggcagttctgct
tcccttccgccccagccgggaagccgggacggcctgcctgcactcaacaccaagatcctg
tacccaaatgtccgggctggaatgtctggttccttacccggtggctcagtcatcagtcgc
ctgttaattaatgctgatccctttaactctgaaccagaaaccctagagtattacacggag
aaatgtgtcatgaacaactattttggcatcggcctggatgcaaagatatccctggacttt
aataacaagcgcgatgaacacccagagaagtgcaggagccgaaccaagaacatgatgtgg
tatggagttcttggaaccaaagagttgctgcacagaacctacaagaacctggaacaaaag
gtcttgctggagtgtgacgggcgacccatcccactccccagtcttcagggaattgctgtc
cttaacattcccagctatgctggaggaaccaacttctgggggggaaccaaggaagatgat
actttcacagctccatcattcgatgacaagattctggaggtggtcgccgtgttcggcagc
atgcagatggccgtctctcgagtcatcaggctgcagcatcatcggatcgcccagtgtcgc
acagtgaagatctccatccttggggatgagggcgtgcctgtgcaggtggacggagaggcc
tgggtccagccgccagggtacattcggattgtccacaagaaccgggcacagacactgacc
agagacagggcatttgagagcaccctgaagtcctgggaagacaagcagaagtgtgagctg
ccccgccctccatcctgttccctgcacccggagatgctgtccgaggaggaggccacccag
atggaccagtttgggcaggcggcgggggtcctcattcacagtatccgagaaatagctcag
tctcatcgggacatggagcaggaactggcccacgccgtcaatgccagctccaagtcgatg
gaccgggtgtatggcaagcccagaaccacagaggggctgaactgcagctttgtcctggaa
atggtgaataacttcagagctctgcgcagtgagacggagctgctgctgtctgggaagatg
gccctgcagctggatccgccgcagaaggagcagctggggagtgctcttaccgagatggac
cgacagctcaggaggctggcagacaccccctggctctgccagtctgcagagcccggcgat
gaagagagcgtgatgctggatcttgccaagcgcagtcgcagtggtaaattccgcctcgtg
accaagtttaaaaaggagaaaaacaacaagaacaaagaagttcacagtagcctggcagcc
ccggttcacctctgggggacagaggaggttgctgcctggctggagcacctcagtctctgt
gagtataaggacatcttcatgcggcacgacatccggggctctgagctcctgcacctggag
cggagggacctcaaggacctgggcgtgaccaaggtgggccacatgaagaggatcctgtgt
ggcatcaaggaactgagccgcagcgctcccgccgccgaggcctag

KEGG   Macaca mulatta (rhesus monkey): 715254
Entry
715254            CDS       T01028                                 

Gene name
DGKB
Definition
(RefSeq) diacylglycerol kinase beta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    715254 (DGKB)
   00564 Glycerophospholipid metabolism
    715254 (DGKB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    715254 (DGKB)
   04072 Phospholipase D signaling pathway
    715254 (DGKB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    715254 (DGKB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     715254 (DGKB)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg C1_2
Other DBs
NCBI-GeneID: 715254
NCBI-ProteinID: XP_014989402
Ensembl: ENSMMUG00000020418
UniProt: I2CTX4
LinkDB
Position
3
AA seq 804 aa
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDF
EGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPR
TTSPANSSSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQ
MMHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVK
DDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVK
SKKNADVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDC
GPLKDHILPPTTICPVVLQTLPTSGVSVPEERQSTVKKEKSGSQQPNKVIDKNKMQRANS
VTVDGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLAGNGPMPGL
NFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYE
GENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFH
IMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIA
ILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGL
EGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPM
LMGPPPKTGLFCSLVKRTRNRSKE
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgacaaaccaggaaaaatgggcccacctcagcccttcggaattttcccaacttcagaaa
tatgctgagtattctacaaagaaattaaaggatgttcttgaagaattccatggtaatggt
gtgcttgcaaagtataatcctgaagggaaacaagacattcttaaccaaacaatagatttt
gaaggtttcaaactattcatgaagacattcctggaagccgagcttcctgatgatttcact
gcacaccttttcatgtcatttagcaacaagtttcctcattctagtccaatggtaaaaagt
aaacctgctctcctatcaggcggtctgagaatgaataaaggtgccatcacccctccccgg
actacttctcctgcaaattcaagttccccagaagtaatccacctgaaggacattgtctgt
tacctgtctctgcttgaaagaggaagacctgaggataagcttgagtttatgtttcgcctt
tatgacacggatgggaatggcttcctggacagctcggagctagaaaatatcatcagtcag
atgatgcatgttgcagaataccttgagtgggatgtcactgaacttaatccaatcctccat
gaaatgatggaagaaattgactatgatcatgacggaactgtgtctctggaggaatggatt
caaggaggaatgacaacaattccacttcttgtgctcctgggcttagaaaataacgtgaag
gatgatggacagcacgtgtggcgactgaagcactttaacaaacctgcctattgcaacctt
tgcctgaacatgctgattggtgtggggaagcagggcctctgctgttccttctgcaagtac
acagtccatgagcgctgtgtggctcgagcaccgccctcttgcatcaagacctatgtgaag
tccaaaaagaacgctgatgtcatgcaccattactgggttgaaggtaactgcccaaccaag
tgtgataagtgccacaaaactgttaaatgttaccagggcctgacaggactgcattgtgtt
tggtgtcagatcacactgcataataaatgtgcttctcatctaaaacctgaatgtgactgt
ggacctttgaaggaccatattttaccacccacaacaatctgtccagtggtactgcagact
ctgcccacttcaggagtttctgttcctgaggaaagacaatcaacagtgaaaaaggaaaag
agtggttcccagcagccaaacaaagtgatagacaagaataaaatgcaaagagccaactct
gttactgtcgatggacaaggcctgcagatcactcctgtgcctggtactcacccactttta
gtttttgtgaaccccaaaagtggtggaaaacaaggagaacgaatttacagaaaattccag
tatctactaaatcctcgtcaggtttacagtcttgctggaaatggaccaatgccagggtta
aactttttccgtgatgtccctgacttcagagtgttagcctgtggtggagacggaaccgtg
ggctgggttttggattgcatagaaaaggccaatgtaggcaagcatcctccagttgcaatt
ctgcctcttgggactggcaacgatctagcgagatgcctgcgatggggaggaggttatgaa
ggtgagaatttgatgaaaattctaaaagacattgaaaacagcacagaaatcatgttggac
aggtggaagtttgaagtcatacctaatgacaaagatgagaagggagacccagtgccttac
agtatcatcaataattacttttccattggcgtggatgcctccattgcacacagattccac
atcatgagagaaaaacacccagagaaattcaacagtagaatgaagaataaattttggtat
tttgagtttggcacatctgaaactttctcagccacctgcaagaagctacatgaatctgta
gaaatagaatgtgatggagtacagatagatttaataaacatctctctggaaggaattgct
attttgaatataccaagcatgcatggaggatccaatctttggggagagtctaagaaaaga
cgaagccatcgacgaatagagaaaaaagggtctgacaaaaggaccaccgtcacagatgcc
aaagagttgaagtttgcaagtcaagatctcagtgaccagctgctggaggtggtcggcttg
gaaggagccatggagatggggcaaatatacacaggcctgaaaagtgctggccggcggctg
gctcaatgctcctgtgtggtcatcaggactagcaagtctctgccaatgcaaattgatggg
gagccatggatgcagaccccatgcacaataaaaattacacacaagaaccaagctccgatg
ctgatgggccctcctccaaaaaccgggttattctgctccctcgtcaaaaggacaagaaac
cgaagcaaggaataa

DBGET integrated database retrieval system