KEGG   Macaca mulatta (rhesus monkey): 697250
Entry
697250            CDS       T01028                                 

Gene name
GJD2
Definition
(RefSeq) gap junction delta-2 protein
  KO
K07373  gap junction delta-2 protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    697250 (GJD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    697250 (GJD2)
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   697250 (GJD2)
SSDB
Motif
Pfam: Connexin
Other DBs
NCBI-GeneID: 697250
NCBI-ProteinID: XP_001087723
Ensembl: ENSMMUG00000007028
UniProt: F7F204
LinkDB
Position
7
AA seq 321 aa
MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP
GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP
PESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSG
LRTASKSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV
ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSIYEIRNK
DLPRVSVPNFGRTQSSDSAYV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgggggaatggaccatcttggagaggctgctggaagccgcggtgcagcagcactccact
atgatcgggaggatcctgttgactgtggtagtgatcttccggatcctcattgtggccatt
gtgggggagacggtgtacgatgatgagcagaccatgtttgtgtgcaacaccctgcaaccc
ggctgtaaccaggcctgctacgaccgcgccttccccatctcccacatacgttactgggtc
ttccagatcataatggtgtgtacccccagtctttgcttcatcacctactctgtgcatcag
tccgccaagcagcgagaacgccgctactctactgtcttcctagccctggacagagacccc
cccgagtccataggaggtcctggaggaactgggggtgggggcagtggtgggggcaaacga
gaagataagaagttgcaaaatgctattgtcaatggggtgctgcagaacacagagaacacc
agtaaggagacagagccagattgtttagaggttaaggagctgactccacacccatcaggg
ctacgcactgcatcaaaatccaagctcagaaggcaggaaggcatctcccgcttctacatt
atccaagtggtgttccgaaatgccctggaaattgggttcctggtaggccaatattttctc
tatggatttagtgtcccagggctgtatgagtgtaaccgctacccctgcatcaaggaggtg
gaatgttatgtgtcccggccaactgagaagactgtcttcctagtgttcatgtttgctgta
agtggcatctgtgttgtgctcaacctggccgaactcaaccacctgggatggcgcaagatc
aagctggctgtgcgaggggctcaggccaagagaaagtcaatctatgagattcgtaacaag
gacctgcccagggtcagtgttcccaattttggcaggactcagtccagtgactctgcctat
gtgtga

KEGG   Macaca mulatta (rhesus monkey): 714344
Entry
714344            CDS       T01028                                 

Gene name
GJA1
Definition
(RefSeq) gap junction alpha-1 protein
  KO
K07372  gap junction alpha-1 protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04540  Gap junction
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    714344 (GJA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    714344 (GJA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    714344 (GJA1)
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   714344 (GJA1)
SSDB
Motif
Pfam: Connexin Connexin43 Connexin40_C Ammonium_transp 7tm_1
Other DBs
NCBI-GeneID: 714344
NCBI-ProteinID: NP_001247996
Ensembl: ENSMMUG00000005225
UniProt: F7C314 G7MQM0
LinkDB
Position
4
AA seq 382 aa
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG
VNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGKSDPYHATSGALSPTKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgactggagcgccttaggcaaactccttgacaaggttcaagcctactcaactgct
ggagggaaggtgtggctgtcagtacttttcattttccgaatcctgctactggggacagca
gttgagtcagcctggggagatgagcagtctgcctttcgttgtaacactcaacaacctggt
tgtgaaaacgtctgctatgacaagtctttcccaatctctcatgtgcgtttctgggtcctg
cagatcatatttgtgtctgtgcccacactcttgtacctggctcatgtgttctatgtgatg
cgaaaggaagagaaactaaacaagaaagaggaggaactcaaggttgcccaaactgatggt
gtcaatgtggagatgcacttgaagcagattgagataaagaagttcaagtatggtattgaa
gagcatggtaaagtgaaaatgcgaggggggttgctgcgaacctacatcatcagtatcctc
ttcaagtctatctttgaggtggccttcttgctgatccagtggtacatctatggattcagc
ctgagtgctgtttacacttgcaaaagagatccctgcccacatcaggtggactgtttcctc
tctcgccccacggagaaaaccatcttcatcatcttcatgctggtggtgtccttggtgtcc
ctggccttgaatatcattgaactcttctatgttttcttcaagggcgttaaggatcgggtt
aagggaaagagcgacccttaccatgcgaccagtggcgcactgagccccaccaaagactgt
gggtctcaaaaatatgcttatttcaatggctgctcctcaccaaccgctcccctctcgcct
atgtctcctcctgggtacaagctggttactggcgacagaaacaattcttcttgccgcaat
tacaacaagcaagcaagtgagcaaaactgggctaattacagtgcagaacaaaatcgaatg
gggcaggcgggaagcaccatctctaactcccatgcacagccttttgatttccctgatgat
aaccagaattctaaaaagctagctgctggacacgaactacagccgctagccattgtggac
cagcgaccttcaagcagagccagcagtcgtgccagcagcagacctcggcctgacgacctg
gagatctag

DBGET integrated database retrieval system