KEGG   Macaca mulatta (rhesus monkey): 697835
Entry
697835            CDS       T01028                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697835 (GADD45G)
   04064 NF-kappa B signaling pathway
    697835 (GADD45G)
   04068 FoxO signaling pathway
    697835 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    697835 (GADD45G)
   04210 Apoptosis
    697835 (GADD45G)
   04115 p53 signaling pathway
    697835 (GADD45G)
   04218 Cellular senescence
    697835 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697835 (GADD45G)
   05202 Transcriptional misregulation in cancer
    697835 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    697835 (GADD45G)
   05212 Pancreatic cancer
    697835 (GADD45G)
   05225 Hepatocellular carcinoma
    697835 (GADD45G)
   05226 Gastric cancer
    697835 (GADD45G)
   05214 Glioma
    697835 (GADD45G)
   05216 Thyroid cancer
    697835 (GADD45G)
   05220 Chronic myeloid leukemia
    697835 (GADD45G)
   05217 Basal cell carcinoma
    697835 (GADD45G)
   05218 Melanoma
    697835 (GADD45G)
   05213 Endometrial cancer
    697835 (GADD45G)
   05224 Breast cancer
    697835 (GADD45G)
   05222 Small cell lung cancer
    697835 (GADD45G)
   05223 Non-small cell lung cancer
    697835 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    697835 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    697835 (GADD45G)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     697835 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     697835 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 697835
NCBI-ProteinID: NP_001180839
Ensembl: ENSMMUG00000048737
UniProt: G7NEM9 F7GZG4
LinkDB
Position
15
AA seq 159 aa
MTLEEVRGQDTVPESTDRMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagacaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtccgcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgc
gtgctggctgccgatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggcgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Macaca mulatta (rhesus monkey): 701054
Entry
701054            CDS       T01028                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    701054 (GADD45A)
   04064 NF-kappa B signaling pathway
    701054 (GADD45A)
   04068 FoxO signaling pathway
    701054 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    701054 (GADD45A)
   04210 Apoptosis
    701054 (GADD45A)
   04115 p53 signaling pathway
    701054 (GADD45A)
   04218 Cellular senescence
    701054 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701054 (GADD45A)
   05202 Transcriptional misregulation in cancer
    701054 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    701054 (GADD45A)
   05212 Pancreatic cancer
    701054 (GADD45A)
   05225 Hepatocellular carcinoma
    701054 (GADD45A)
   05226 Gastric cancer
    701054 (GADD45A)
   05214 Glioma
    701054 (GADD45A)
   05216 Thyroid cancer
    701054 (GADD45A)
   05220 Chronic myeloid leukemia
    701054 (GADD45A)
   05217 Basal cell carcinoma
    701054 (GADD45A)
   05218 Melanoma
    701054 (GADD45A)
   05213 Endometrial cancer
    701054 (GADD45A)
   05224 Breast cancer
    701054 (GADD45A)
   05222 Small cell lung cancer
    701054 (GADD45A)
   05223 Non-small cell lung cancer
    701054 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    701054 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    701054 (GADD45A)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     701054 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     701054 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 701054
NCBI-ProteinID: NP_001248234
Ensembl: ENSMMUG00000038425
UniProt: F7HPG4
LinkDB
Position
1
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAATEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaagcggccaaactgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgaccgagatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgaccgagggcgcggagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccggtgatt
aatctccctgaacggtga

KEGG   Macaca mulatta (rhesus monkey): 711257
Entry
711257            CDS       T01028                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711257 (GADD45B)
   04064 NF-kappa B signaling pathway
    711257 (GADD45B)
   04068 FoxO signaling pathway
    711257 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    711257 (GADD45B)
   04210 Apoptosis
    711257 (GADD45B)
   04115 p53 signaling pathway
    711257 (GADD45B)
   04218 Cellular senescence
    711257 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711257 (GADD45B)
   05202 Transcriptional misregulation in cancer
    711257 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    711257 (GADD45B)
   05212 Pancreatic cancer
    711257 (GADD45B)
   05225 Hepatocellular carcinoma
    711257 (GADD45B)
   05226 Gastric cancer
    711257 (GADD45B)
   05214 Glioma
    711257 (GADD45B)
   05216 Thyroid cancer
    711257 (GADD45B)
   05220 Chronic myeloid leukemia
    711257 (GADD45B)
   05217 Basal cell carcinoma
    711257 (GADD45B)
   05218 Melanoma
    711257 (GADD45B)
   05213 Endometrial cancer
    711257 (GADD45B)
   05224 Breast cancer
    711257 (GADD45B)
   05222 Small cell lung cancer
    711257 (GADD45B)
   05223 Non-small cell lung cancer
    711257 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    711257 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    711257 (GADD45B)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     711257 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     711257 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 711257
NCBI-ProteinID: NP_001247803
Ensembl: ENSMMUG00000003468
UniProt: F7EBI6 G7NL74
LinkDB
Position
19
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIMRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagctgttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgcgacaacgacattaacatcatgcgggtgtcgggcatgcagcgcctggcacag
ctcctgggagagccggccgagacccagggcaccactgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtagccagc
tactgcgaagaaagccggggcaacaaccagtgggtgccctacatctctcttcaggaacgc
tga

DBGET integrated database retrieval system