KEGG   Macaca mulatta (rhesus monkey): 698160
Entry
698160            CDS       T01028                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X1
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04210  Apoptosis
mcc04217  Necroptosis
mcc04622  RIG-I-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc05132  Salmonella infection
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698160 (TRADD)
   04064 NF-kappa B signaling pathway
    698160 (TRADD)
   04668 TNF signaling pathway
    698160 (TRADD)
   04071 Sphingolipid signaling pathway
    698160 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    698160 (TRADD)
   04217 Necroptosis
    698160 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    698160 (TRADD)
   04657 IL-17 signaling pathway
    698160 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    698160 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    698160 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    698160 (TRADD)
   05152 Tuberculosis
    698160 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    698160 (TRADD)
   05160 Hepatitis C
    698160 (TRADD)
   05164 Influenza A
    698160 (TRADD)
   05162 Measles
    698160 (TRADD)
   05168 Herpes simplex virus 1 infection
    698160 (TRADD)
   05163 Human cytomegalovirus infection
    698160 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    698160 (TRADD)
   05169 Epstein-Barr virus infection
    698160 (TRADD)
   05165 Human papillomavirus infection
    698160 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 698160
NCBI-ProteinID: XP_014981851
Ensembl: ENSMMUG00000005908
LinkDB
Position
20
AA seq 365 aa
MVNSCPRYANQWWGQLNHVGLEVTVETLNHVGLDGCLQGRGRGDELDTRLSASPGGEMAA
GQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPEVLQMLK
IHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRTLAAALAQRSVALQLELRAGAE
RLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGTQGGDGEVTSAPSQPP
VPSLSDVKPPPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGCRALRDP
ALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDP
NGGLA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggtgaactcctgtcccaggtatgccaaccagtggtggggacaactgaaccatgtggga
cttgaggttactgtggagacgctgaaccacgtggggctggacggttgtctccagggcaga
gggaggggggatgaactggatacccgactgtctgcatctccaggaggtgagatggcagct
gggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggaatcctcgctg
gacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggcagtgtacagg
gctctgcaggctgccttggcagagagcggcgggagcccggaagtgctgcagatgctgaag
atccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcggcagccctgc
ggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcagaggaccctg
gcggccgcactcgcccagcgttccgtggcgctgcaactggagctgcgcgccggcgctgag
cggctggacgctttgctggcggacgaggagcgctgtttgagttgtatcctagcccagcag
cccgaccggctccgggatgaagaactggccgagctggaggatgcgctgcgaaatctgaag
tgcggctcggggacccagggtggcgacggggaggtcacatcggccccctcgcagcccccg
gtgccctctctgtcggatgtgaagccgccacctgcccagacttttctgttccagggtcag
cctgtagtgaaccggccgctgagcctgcaggaccaacagacgttcgcgcgctccgtgggc
ctcaaatggcgcaaggtggggcgttcgctgcagcggggctgccgggcgctgcgggacccg
gcgctggattcgctggcttacgagtacgagcgcgagggactgtacgagcaggccttccag
ctgctgcggcgcttcgtgcaggccgagggccgccgcgccacgctgcagcgcctggtggag
gcacttgaggagaacgagctcaccagcctggcagaggacttgctgggcctgaccgatccc
aatggcggcctggcttag

DBGET integrated database retrieval system