KEGG   Macaca mulatta (rhesus monkey): 706123
Entry
706123            CDS       T01028                                 

Gene name
AXL
Definition
(RefSeq) tyrosine-protein kinase receptor UFO isoform X1
  KO
K05115  AXL receptor tyrosine kinase [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    706123 (AXL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    706123 (AXL)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     706123 (AXL)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   706123 (AXL)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase fn3 Ig_3 Ig_2 I-set ig V-set C2-set_2 DUF4381 Pkinase_fungal APH MFS_1 DUF2627
Other DBs
NCBI-GeneID: 706123
NCBI-ProteinID: XP_028695606
Ensembl: ENSMMUG00000009145
LinkDB
Position
19
AA seq 911 aa
MAWRCPRMGRVPLAWCLALCGWVCMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRIASLQLSDAGQYQCLVF
LGHQNFVSQPGYVGLEGLPYFLEEPEDRTVAANTHFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGHGPQRNLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAMLSDNEVGIQAGEPDPPEEPLTLQASVPPHQLRLGSLH
PHTPYYIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLESWIQGLIHDLFLVPPIVKETSAPAFSWPWWYILLGAVVAAAC
VLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK
EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFL
SEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVY
LPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYY
RQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLR
QGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVN
MDEGGGYPEPPGAAGGADPPTQLDPKDSCSCLTSAEVHPAGRYVLCPSTAPSPAQPADRG
SPAAPGQEDGA
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggcgtggcggtgccccaggatgggcagggtcccgctggcctggtgcttggcgctgtgc
ggctgggtgtgcatggcccccaggggcacacaggctgaagaaagtcctttcgtgggtaac
ccagggaatatcacaggtgcccggggactcacgggcacccttcggtgtcagctccaggtt
cagggagagccccccgaggtacactggcttcgggacggacagatcctggagctcgcggac
agtacccagacccaggtgcccctgggtgaagatgagcaggatgactggatagtggtcagc
cagctcagaatcgcctccctacagctttccgacgcgggacagtaccagtgtttggtgttt
ctgggacatcagaacttcgtgtcccagcctggctacgtagggctggagggcttgccttac
ttcctggaggagcctgaggacaggactgtggccgccaacacccacttcaacctgagctgc
caagcccagggacccccagagcccgtggacctactctggctccaggatgctgtccccctg
gccacagctccaggtcatggtccccagcgcaacctgcatgttccagggctgaacaagaca
tcctctttctcctgcgaagcccataacgccaagggggtcaccacatcccgcacggccacc
atcacagtgctcccccagcagccccgtaacctccatctggtctcccgccaacccacggag
ctggaggtggcttggactccaggcctgagcggcatctaccccctgacccactgcaccctg
caggctatgctgtcagacaatgaggtgggcatccaggcgggagaaccagaccccccagag
gagcccctcaccttgcaagcatctgtgcccccccaccagcttcggctgggcagcctccat
cctcacaccccttattacatccgtgtggcatgcaccagcagccagggcccctcatcctgg
acacactggcttcctgtggagacgccggagggagtgcccctgggcccccctgagaacatt
agtgccacgcggaatgggagccaggccttcgtgcattggcaggagccccgggcgcccctg
cagggtaccctgttagggtaccggctggcgtatcaaggccaggacaccccagaggtgcta
atggacatagggctaaggcaagaggtgaccctggagctgcagggggacgggtctgtgtcc
aatctgacagtgtgtgtggcagcctacactgctgctggggatggaccctggagcctccca
gtacccctggaggcctggcgcccagggcaagcacagccagtccaccagctggagagctgg
atccaaggcctcatccatgacctgttcctcgtacccccgatagtgaaggaaacttcagct
cctgccttctcgtggccctggtggtatatactgctaggagcagtcgtggccgctgcctgt
gtcctcatcttggctctcttccttgtccaccggcgaaagaaggagacccgttatggagaa
gtgttcgagccaacagtggaaagaggtgaactggtagtcaggtaccgcgtgcgcaagtcc
tacagtcgccggaccactgaagctaccttgaacagcctgggcatcagtgaagagctgaag
gagaagctgcgggatgtgatggtggaccggcacaaggtggccctggggaagactctggga
gaaggagagtttggagccgtgatggaaggccagctcaaccaggacgactccatcctcaag
gtggctgtgaagacaatgaagattgccatctgcacaaggtcagagctggaggatttcctg
agtgaagcagtctgcatgaaggaattcgaccatcccaatgtcatgaggctcatcggtgtc
tgtttccagggttctgaacgagagagctttccagcacctgtggtcatcttacctttcatg
aagcatggagacctacacagcttcctcctctattcccggcttggggaccagccagtgtac
ctgcccactcagatgctagtgaagttcatggcggacatcgccagtggcatggaatatctg
agtaccaagagattcatacaccgggacctggcggccaggaactgcatgctgaatgagaac
atgtccgtgtgtgtggcggacttcgggctctccaagaagatctacaacggggactactac
cgccagggacgtatcgccaagatgccagtcaagtggattgccattgagagtctagctgac
cgtgtctacacgagcaagagtgatgtgtggtccttcggggtgacaatgtgggagattgcc
acaagaggccaaaccccatatccaggcgtggagaacagcgagatttatgactatctgcgc
cagggaaatcgcctgaagcagcctgcggactgtctggatggactgtatgccttgatgtcg
cggtgctgggagctaaatccccaggaccggccaagttttacagagctgcgggaagatttg
gagaacacactgaaggccttgcctcctgcccaggagcctgacgaaatcctctatgtcaac
atggatgaaggtggaggttatcctgaacctcccggcgctgctggaggagctgacccccca
acccagctagaccctaaggattcctgtagctgcctcacttcggctgaggtccatcctgct
ggacgctatgtcctctgcccttccacagcccctagccccgctcagcctgctgataggggc
tccccagcagccccagggcaggaggatggcgcctga

DBGET integrated database retrieval system