KEGG   Macaca mulatta (rhesus monkey): 709089
Entry
709089            CDS       T01028                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04714  Thermogenesis
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05034  Alcoholism
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    709089 (NRAS)
   04012 ErbB signaling pathway
    709089 (NRAS)
   04014 Ras signaling pathway
    709089 (NRAS)
   04015 Rap1 signaling pathway
    709089 (NRAS)
   04370 VEGF signaling pathway
    709089 (NRAS)
   04371 Apelin signaling pathway
    709089 (NRAS)
   04068 FoxO signaling pathway
    709089 (NRAS)
   04072 Phospholipase D signaling pathway
    709089 (NRAS)
   04071 Sphingolipid signaling pathway
    709089 (NRAS)
   04151 PI3K-Akt signaling pathway
    709089 (NRAS)
   04150 mTOR signaling pathway
    709089 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    709089 (NRAS)
   04137 Mitophagy - animal
    709089 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    709089 (NRAS)
   04218 Cellular senescence
    709089 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    709089 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    709089 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    709089 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    709089 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    709089 (NRAS)
   04660 T cell receptor signaling pathway
    709089 (NRAS)
   04662 B cell receptor signaling pathway
    709089 (NRAS)
   04664 Fc epsilon RI signaling pathway
    709089 (NRAS)
   04062 Chemokine signaling pathway
    709089 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    709089 (NRAS)
   04929 GnRH secretion
    709089 (NRAS)
   04912 GnRH signaling pathway
    709089 (NRAS)
   04915 Estrogen signaling pathway
    709089 (NRAS)
   04917 Prolactin signaling pathway
    709089 (NRAS)
   04921 Oxytocin signaling pathway
    709089 (NRAS)
   04926 Relaxin signaling pathway
    709089 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    709089 (NRAS)
   04919 Thyroid hormone signaling pathway
    709089 (NRAS)
   04916 Melanogenesis
    709089 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    709089 (NRAS)
   04726 Serotonergic synapse
    709089 (NRAS)
   04720 Long-term potentiation
    709089 (NRAS)
   04730 Long-term depression
    709089 (NRAS)
   04722 Neurotrophin signaling pathway
    709089 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    709089 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    709089 (NRAS)
   04213 Longevity regulating pathway - multiple species
    709089 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    709089 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709089 (NRAS)
   05206 MicroRNAs in cancer
    709089 (NRAS)
   05205 Proteoglycans in cancer
    709089 (NRAS)
   05203 Viral carcinogenesis
    709089 (NRAS)
   05230 Central carbon metabolism in cancer
    709089 (NRAS)
   05231 Choline metabolism in cancer
    709089 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    709089 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    709089 (NRAS)
   05225 Hepatocellular carcinoma
    709089 (NRAS)
   05226 Gastric cancer
    709089 (NRAS)
   05214 Glioma
    709089 (NRAS)
   05216 Thyroid cancer
    709089 (NRAS)
   05221 Acute myeloid leukemia
    709089 (NRAS)
   05220 Chronic myeloid leukemia
    709089 (NRAS)
   05218 Melanoma
    709089 (NRAS)
   05211 Renal cell carcinoma
    709089 (NRAS)
   05219 Bladder cancer
    709089 (NRAS)
   05215 Prostate cancer
    709089 (NRAS)
   05213 Endometrial cancer
    709089 (NRAS)
   05224 Breast cancer
    709089 (NRAS)
   05223 Non-small cell lung cancer
    709089 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    709089 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    709089 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    709089 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    709089 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    709089 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    709089 (NRAS)
   05161 Hepatitis B
    709089 (NRAS)
   05160 Hepatitis C
    709089 (NRAS)
   05163 Human cytomegalovirus infection
    709089 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709089 (NRAS)
   05165 Human papillomavirus infection
    709089 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    709089 (NRAS)
   01522 Endocrine resistance
    709089 (NRAS)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    709089 (NRAS)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   709089 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   709089 (NRAS)
  Exosomal proteins of breast cancer cells
   709089 (NRAS)
  Exosomal proteins of colorectal cancer cells
   709089 (NRAS)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    709089 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 709089
NCBI-ProteinID: XP_015004311
Ensembl: ENSMMUG00000049105
UniProt: A0A1D5QQS3 G7MIK1
LinkDB
Position
1
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattaccatgtgtggtgatgtaa

DBGET integrated database retrieval system