KEGG   Macaca mulatta (rhesus monkey): 711672
Entry
711672            CDS       T01028                                 

Gene name
MAP2K5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5 isoform X4
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04540  Gap junction
mcc04722  Neurotrophin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711672 (MAP2K5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    711672 (MAP2K5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    711672 (MAP2K5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    711672 (MAP2K5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    711672 (MAP2K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711672 (MAP2K5)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     711672 (MAP2K5)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   711672 (MAP2K5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Pkinase_fungal Kinase-like Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 711672
NCBI-ProteinID: XP_014998032
Ensembl: ENSMMUG00000014482
UniProt: H9EPL8
LinkDB
Position
7
AA seq 448 aa
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEQVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNAAVVSMWVCRALEERRSQQGPP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccttttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactctgggccgcagttactc
ttcagggatgtactggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacggtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtccccagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcattggattttatggagcattttttgtagaaaataggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacaagtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattccgatgtctgg
agcttaggaatctcttttatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccagttggagagttctcggagccgtttgtacatttcatcactcagtgtatg
cgaaaacagccaaaagaaaggccagcacctgaagaattgatgggccacccgttcatcgtg
cagttcaatgacggaaacgccgctgtggtgtccatgtgggtgtgccgggcgctggaggag
aggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system