KEGG   Macaca mulatta (rhesus monkey): 719117
Entry
719117            CDS       T01028                                 

Gene name
GPCPD1
Definition
(RefSeq) glycerophosphocholine phosphodiesterase GPCPD1
  KO
K18695  glycerophosphocholine phosphodiesterase GPCPD1 [EC:3.1.4.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    719117 (GPCPD1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    719117 (GPCPD1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.2  glycerophosphocholine phosphodiesterase
     719117 (GPCPD1)
SSDB
Motif
Pfam: GDPD CBM_20 PI-PLC-X
Other DBs
NCBI-GeneID: 719117
NCBI-ProteinID: XP_015004946
Ensembl: ENSMMUG00000001809
UniProt: G7N2X2 A0A5F8AD33
LinkDB
Position
10
AA seq 672 aa
MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSR
GVSVQYRYFKGYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
TLDSGWLTCQTEIRLRLHYSEKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPLPG
YTCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMN
LFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRS
RTTPIAMSFAQFENLLGINAHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKE
LGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGDPDIH
VDANGIDNVENA
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgacaccttctcaggttgcctttgaaataagaggaactcttttaccaggagaagttttt
gcaatatgtggaagctgtgatgctttgggaaactggaatcctcaaaatgctgtggctctt
cttccagagaatgacacaggtgaaagcatgttatggaaagcaaccattgtactcagtaga
ggagtatcagttcagtatcgctacttcaaagggtactttctagaaccaaagactatcggt
ggtccatgtcaagtgatagttcacaagtgggagactcatctacaaccacgatcaataacc
cctttagaaagcgaaattattattgacgatggacaatttggaatccacaatggtgttgaa
actctggattctggatggctgacgtgtcagactgaaataagattacgtttgcattattct
gaaaaacctcctgtgtcaataaccaagaaaaaactaaaaaaatctagatttagagtgaag
ctgacactagaaggcctggaggaagatgacgatgatagggtatctcccactgtactccac
aaaatgtccaatagcttggagatatccttaataagcgacaatgagttcaagtgcaggcat
tcacagccggagtgtggttatggcttacagcctgatcgttggacagagtacagcatacag
acaatggaaccagataacctggaactaatctttgacttttttgaagaagatctcagtgag
cacgtagttcagggtgatgcccttcctggacatgtgggtacagcttgtctcttatcatcc
accattgctgagagtggaaagagtgctggaattcttactcttcccatcatgagcagaaat
tccaggaaaacaataggcaaagtgagagttgactatataattatcaagccattaccagga
tacacttgtgacatgaaatcttcattttccaagtattggaagccaagaataccattggat
gttggccatcgaggtgcaggaaactctacaacaactgcccagctggctaaagttcaagaa
aatactattgcttctttaagaaatgctgctagtcatggtgcagcctttgtagaatttgat
gtacacctttcaaaggactttgtgcccgtggtatatcatgatcttacctgttgtttgact
atgaaaaagaaatttgatgctgatccagttgaattatttgaaattccagtaaaagaatta
acatttgaccaactccagttgttaaagctcactcatgtgactgcattgaaatctaaggat
cggaaagaatctgtggtccaggaggaaaattccttttcagaaaatcagccatttccttct
cttaagatggttttagagtctttgccagaagatgtagggtttaacattgaaataaaatgg
atctgccaacaaagggatggaatgtgggatggtaacttatcaacatattttgacatgaat
ctgtttttggatataattttaaaaactgttttagaaaattctgggaagaggagaatagtg
ttttcttcatttgatgcagatatttgcacaatggttcggcaaaagcagaacaaatatccc
atactatttttaactcaaggaaaatctgagatttatcccgaactcatggacctcagatct
cggacaacccccattgcaatgagctttgcacagttcgaaaatctactggggataaatgca
catactgaagacttgctcagaaacccgtcctatattcaagaggcaaaagctaagggacta
gtcatattctgctggggtgatgacaccaatgatcctgaaaacagaaggaaattgaaggaa
cttggagttaatggtctaatttatgataggatatatgattggatgcctgaacaaccaaat
atattccaagtggagcaattggaacgcctgaagcaagaattgccagagcttaagagctgt
ttgtgtcccactgttagccgctttgtcccctcatctttgtgtggggatcctgatatccac
gtggatgccaacggcattgataacgtggagaatgcttag

DBGET integrated database retrieval system