KEGG   Macaca mulatta (rhesus monkey): 720697Help
Entry
720697            CDS       T01028                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00071  Fatty acid degradation
mcc01212  Fatty acid metabolism
mcc03320  PPAR signaling pathway
mcc04152  AMPK signaling pathway
mcc04714  Thermogenesis
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    720697 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    720697 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    720697 (CPT1B)
   04920 Adipocytokine signaling pathway
    720697 (CPT1B)
   03320 PPAR signaling pathway
    720697 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    720697 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    720697 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcc03029]
    720697 (CPT1B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     720697 (CPT1B)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    720697 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 720697
NCBI-ProteinID: NP_001276885
Ensembl: ENSMMUG00000003121
UniProt: G7N4F6 I0FJX3
LinkDB All DBs
Position
10
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSSFCNVDVSLGLVGCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLSYHGWMFEMHGKTSNLTRIWAMCVRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMEMLAKEFQNKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRVPGKETDVLQHLSDSRHVAVYHKGRFFKLWLYEGSRLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYRYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALPPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMVEKSHAKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRQALLDLADLFQVPKTDS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggccgtggccttccagttcacggtgaccccagagggggtcgac
ttccggctcagtcgggaggccctgaaacatgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcgtcatggcaacagtgggttcctccttctgcaacgtggacgtctcc
ttggggctggtcggttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctcctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtgtccgccttctatcc
agccggcaccccatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagatgctggccaaagaattccagaacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcgagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactactatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacatcatccatgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactaggc
atagtgcccatgtgctcctatcagatggagaggatgttcaacaccactcgggtcccgggc
aaggagacagatgtgctgcagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggctcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaacaaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggagtcctaccgctatgaccccgaagacgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactcttatt
tccttcaagaatggccagctgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
actgggcactgcttgggcaaaccgaaccctgcgctcccacctcctacgcggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgctg
gcagacgatgtggagctgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccccgacgcctttgtgcagatcgcactgcagctggcgcacttccgg
gacaggggtaagttctgcctgacttatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagcgagtccacagcctttgtgcaggctatggtg
gagaagtcccatgcgaaagcagacctgcgagatctgttccagaaagctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctgggagtcagctctcctttcctcgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccgcatgtttgacccagag
cagcaccccaatcacctgggtgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgatcgcgggtgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaatgcccagcgctttggaaaccacatccgccaagccctgctggac
ctcgctgatcttttccaagtgcccaagaccgacagctga

DBGET integrated database retrieval system