KEGG   Macaca fascicularis (crab-eating macaque): 102134273
Entry
102134273         CDS       T02918                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04068  FoxO signaling pathway
mcf04144  Endocytosis
mcf04218  Cellular senescence
mcf04350  TGF-beta signaling pathway
mcf04380  Osteoclast differentiation
mcf04390  Hippo signaling pathway
mcf04520  Adherens junction
mcf04659  Th17 cell differentiation
mcf04926  Relaxin signaling pathway
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05142  Chagas disease
mcf05161  Hepatitis B
mcf05166  Human T-cell leukemia virus 1 infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05210  Colorectal cancer
mcf05212  Pancreatic cancer
mcf05220  Chronic myeloid leukemia
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102134273 (TGFBR2)
   04350 TGF-beta signaling pathway
    102134273 (TGFBR2)
   04390 Hippo signaling pathway
    102134273 (TGFBR2)
   04068 FoxO signaling pathway
    102134273 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102134273 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102134273 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102134273 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102134273 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102134273 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102134273 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102134273 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102134273 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    102134273 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102134273 (TGFBR2)
   05212 Pancreatic cancer
    102134273 (TGFBR2)
   05225 Hepatocellular carcinoma
    102134273 (TGFBR2)
   05226 Gastric cancer
    102134273 (TGFBR2)
   05220 Chronic myeloid leukemia
    102134273 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102134273 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102134273 (TGFBR2)
   05161 Hepatitis B
    102134273 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102134273 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102134273 (TGFBR2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102134273 (TGFBR2)
Protein kinases [BR:mcf01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102134273 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102134273
NCBI-ProteinID: XP_005545621
UniProt: A0A2K5WD61
LinkDB
Position
2
AA seq 592 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKGEMICPSCNRTAHPLRHINND
MMVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCLSNCSITSICEKPQEVCVAVWRKNDENI
TLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNT
SNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSSWEAGKPRKLMDFSEH
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggatgtggaaatggaggcccagaaaggt
gaaatgatctgccccagctgtaataggactgcccatccactgagacatattaacaatgac
atgatggtcactgacaacaatggtgcagtcaagtttccacaactgtgtaaattttgtgat
gtgagattttccacctgtgacaaccagaaatcctgcctgagcaactgcagcatcacctcc
atctgtgaaaagccacaggaagtctgtgtggctgtatggagaaagaatgacgagaacata
acactagagacagtttgccatgatcccaagctcccctaccatgactttattctggaagat
gctgcttctccaaagtgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatg
tgttcctgtagctctgatgagtgcaatgacaacatcatcttctcagaagaatacaacacc
agcaatcctgacttgttgctagtcatatttcaagtgacaggcatcagcctcctgccacca
ctgggagttgccatatctgtcatcatcatcttctactgctaccgcgttaaccggcagcag
aagctgagctcatcctgggaagctggcaagccacggaagctcatggacttcagcgagcac
tgtgccatcatcctggaagacgaccgctccgacatcagctccacatgcgccaacaacatc
aaccacaacacagagctgctgcccattgaactggacaccctggtggggaaaggtcgcttt
gctgaggtctataaggccaagctgaagcagaacacttcagagcagtttgagacagtggca
gtcaagatctttccctatgaggagtatgcctcttggaagacggagaaggacatcttctca
gacatcaacctgaagcatgagaacatactccagttcctgacagctgaggagcgcaagacg
gagttggggaaacagtactggctgatcactgccttccatgccaagggcaacctacaggag
tacctgacgcggcatgtcatcagctgggaggacctgcgcaaactgggcagctccctcgcc
cggggcattgcccacctccacagtgatcacactccgtgcgggaggcccaagatgcccatc
gtccacagggacctcaagagctccaatatcctcgtgaagaacgacctgacctgctgcctg
tgtgactttgggctttccctgcgtctggaccctactctgtctgtggatgacctggctaac
agcgggcaggtgggaactgcaagatacatggctccagaagtcctagaatccaggatgaat
ttggagaatgtagagtcctttaagcagaccgatgtctactccatggctctggtgctctgg
gaaatgacatcgcgctgtaatgcggtgggagaagtaaaagattatgagcctccatttggt
tccaaggtgcgggagcacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcga
ggacgaccagaaattcccagcttctggctcaaccaccagggcatccagatggtgtgtgag
acgttgactgagtgctgggaccacgacccagaggcccgcctcacagcccagtgtgtggca
gaacgcttcagtgagctggagcacctggacaggctctcggggaggagctgctccgaggag
aagattcctgaagacggctccctaaacactaccaaatag

DBGET integrated database retrieval system