KEGG   Methyloceanibacter caenitepidi: GL4_0154Help
Entry
GL4_0154          CDS       T03636                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    GL4_0154
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcg03400]
    GL4_0154
Enzymes [BR:mcg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GL4_0154
DNA repair and recombination proteins [BR:mcg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     GL4_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S DNA_ligase_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: BAQ15624
UniProt: A0A0A8K0U2
LinkDB All DBs
Position
complement(158061..160607)
Genome map
AA seq 848 aa AA seqDB search
MASRTATLDDYNAKRNFKATPEPKGSVAKPGGNVYVVQKHDARRLHYDLRLELDGVLKSW
AVTKGPSLDPADKRLAVRTEDHPVDYGTFEGVIPEGYGAGTVMLWDRGTWEPKGDPHEGL
EEGILKFELHGKRLKGGFALVRMKKRKGEKRENWLLVKERDQDADESRDPRKIWTKSVAT
DRGMAAIAEGGTDEGKRAPKAKKSTAKQSGSSAKKKSGLASVSFTPPQLAKLADQPPKGD
AWLHELKYDGYRIQALIKGDEVRLITRNGKDWTDKYPAIADALRTLKVGSAAIDGELVAL
DDAGVSRFGLLQNAADDPSVHLRYYAFDLLSLNGKDLKSEPLLERKEQLEAILKGASKLI
HYSDHIEGSGQAVIEKACALNLEGVVSKKATAPYRSGRGTSWIKSKCIGNDEFVIGGYRK
SERRGRPFASLLLGEYEKDKLVYRGRVGTGFNAKTLDMLHRKMEPLQRKTSPFEKLPADA
RRGAVWVTPKLVAQVSYTERTQDGHLRHPSFLALREDKAAKDVTAVPDEDTSNQDSPDDV
SRDKDNNNDDPVEVLGVKLTHPGRVMFPEQGATKREIAEYYVAFKDHVLTYLKDRPLSIV
RCPSGRGGKCFFQKHYKTSLPDHFRAVSIEQKDGKTSSYLLIDSPEGLVGAAQIGALELH
IWGARADDIERPDRLVFDLDPDDAVPFAAVRDAARELRDVLKAAGLQSFALLTGGKGIHV
ICPLERRREWPDIKTFARGFALKLAEAAPGTYVAQASKEKRKGKIFIDWMRNQRGATAIA
PYSLRARPGAPIATPVSWRELPRIEGAADYTLGNIRSRLAHLKSDPWKGYGAVRQSITNA
ALEFVRGE
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacgtacggccacgctcgacgactacaacgccaagcgaaacttcaaggcgacg
ccagagccgaaggggtccgtcgcgaagccgggcggcaatgtctatgtcgtgcagaagcac
gacgcgcgccgtctgcactacgatctgcggcttgaactggacggcgtgctcaagagctgg
gcagtaaccaaaggtccaagcctcgatccggccgacaagcgcctcgcggttcgcacggaa
gatcaccccgtcgactacggcacgttcgaaggtgtgatcccggaaggctacggtgccgga
acggtgatgctttgggaccggggcacatgggaacccaagggggacccccatgaaggcctc
gaggaaggcattctcaaattcgagctccacggcaagcgtttgaagggcgggtttgcgctt
gtccgcatgaaaaagcggaagggcgagaaacgggagaactggctcctcgtcaaggaacgc
gatcaagacgccgacgagagccgcgacccgcggaaaatctggaccaaaagcgttgcgacg
gaccgcggtatggctgccatcgcggagggcgggaccgacgagggcaagagggccccgaag
gcgaaaaagtcgacggccaagcaatcaggttcgtccgcaaagaaaaagtccggtctggcc
agcgtgagctttacgccaccgcagctggccaagctcgcggaccagccacccaagggcgac
gcctggctgcatgagctgaaatatgacggctatcgcattcaggcgctcatcaagggtgac
gaggtccgcctcatcacgcggaacggcaaagactggaccgacaaataccccgccatcgcc
gacgcgctgcgcacgctgaaagtcggctcagctgcgatcgacggtgagctcgtggccctc
gacgacgcaggcgtcagccgctttggcttgttgcaaaacgcggcggacgatcccagcgtt
cacctccgttattacgccttcgacttgctttccctcaacggcaaagacctgaagtcggag
ccgctgctggagcgcaaagagcagcttgaagcgatcctgaaaggcgcgagcaagctgatc
cactacagcgatcacatcgaggggtcggggcaggctgttatcgagaaggcttgtgccctc
aatctcgaaggcgtcgtctccaagaaggcaaccgccccttatcgatctggacgcggaacg
tcttggatcaaatccaaatgcattgggaacgacgagttcgtcatcggcggctatcgcaaa
tcagagcggcgcggccgtcccttcgcctcgctgctgcttggggagtacgagaaggacaag
ctggtttatcgcggccgcgtcggcactggattcaacgcgaagacactcgatatgctgcat
cgaaagatggagccgttgcagcgcaagacgagccccttcgagaaactgccggctgatgcc
cgccgcggcgcggtctgggtgacgccgaagctcgtggcacaagtctcgtacactgaacgc
actcaggatggccatctccggcatccgagctttttggctttgcgcgaagacaaagccgcc
aaggacgtgaccgcggtgccggacgaagacacgtcaaaccaagactctccagacgacgtc
agccgggacaaagacaacaacaacgacgatcccgtcgaggttcttggcgtcaagctgacc
caccccggccgtgtgatgtttcccgaacagggggcaaccaagcgggagatcgccgagtat
tatgtcgcgttcaaagatcacgtccttacctatctcaaagaccggccgctgagcatcgtg
cgctgtccgtcggggcgtggcggaaagtgctttttccagaagcactacaagacgtcgctc
cccgatcactttagggccgtcagcatcgagcagaaggatggcaagacgtcctcctatttg
ctgatcgattctcccgaggggctcgtcggcgccgcgcagatcggggctctggaactgcac
atttggggcgcgcgcgccgacgatatcgaaaggccggatcggctcgtgttcgacctggat
ccggacgacgccgtaccgttcgcagccgtgcgcgatgccgcgcgggaactgcgcgatgtt
ttgaaggcagcggggctccagtctttcgccttgctcaccggcggcaagggcatccatgtg
atctgtcccttggagcgccggcgcgaatggcccgacatcaagacatttgcgcgggggttc
gctctgaaactcgccgaggcggcgcccggaacctatgtggcgcaagcctccaaggagaag
cggaaaggaaagatctttatcgactggatgcgcaatcagcgcggcgcgacggcgattgcg
ccctattcgctacgcgcgcgccctggtgcaccaatcgcaaccccggtgtcctggcgcgag
ctgccgcgcatcgagggtgccgccgactatacgctcggcaatatacgctcgcgtctcgcc
cacctgaaatccgacccctggaaaggctacggcgcagtgcgacagtccatcaccaatgcc
gcactcgaatttgtgcgcggggaatga

DBGET integrated database retrieval system