KEGG   Methyloceanibacter caenitepidi: GL4_2108Help
Entry
GL4_2108          CDS       T03636                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein MoaC
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00790  Folate biosynthesis
mcg01100  Metabolic pathways
mcg04122  Sulfur relay system
Module
mcg_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GL4_2108
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    GL4_2108
Enzymes [BR:mcg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     GL4_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaC
Motif
Other DBs
NCBI-ProteinID: BAQ17551
UniProt: A0A0A8K436
LinkDB All DBs
Position
complement(2196288..2196779)
Genome map
AA seq 163 aa AA seqDB search
MNSPLKSPLSHLNARGEAHMVDVSEKAVTSRTATAEGFVTMAPATLDMILDGTAPKGDVL
ATARIAGIMGAKKTSDLIPLCHPLALSKVTVDFTPDRENACLRVEATTKVDGKTGVEMEA
LTAVTVACLTLYDMCKAVDRAMSFSGIRLIEKTGGRSGTFRAP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccccttgaagagcccgctgtcgcatctcaacgcgcgcggcgaggcccacatg
gtcgacgtgtcggagaaggctgtcacctcgcgcaccgccaccgccgaaggtttcgtcact
atggcgccggcgacgctcgacatgatcctggacgggacggcgcccaagggcgatgtgctg
gcgacggcgcgtatcgccggcatcatgggtgcaaagaaaacctcggaccttattcccctg
tgccaccccttggcgctgtcgaaggtcacggtcgattttacaccggaccgtgagaatgcg
tgcctgcgcgtcgaggcgacgacgaaggtcgacggcaagaccggcgtcgagatggaggcg
ttgactgccgtcacggtcgcctgcctcacgctctacgatatgtgcaaggccgtggaccgg
gccatgagcttctcgggcatccgcctgatcgagaagacgggtggccgctccggcacgttc
cgcgcgccttaa

DBGET integrated database retrieval system