KEGG   Methylorubrum extorquens CM4: Mchl_2793Help
Entry
Mchl_2793         CDS       T00809                                 

Definition
(GenBank) Hemolysin-type calcium-binding region
Organism
mch  Methylorubrum extorquens CM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemolysinCabind
Motif
Other DBs
NCBI-ProteinID: ACK83632
UniProt: B7KPP6
LinkDB All DBs
Position
complement(2946471..2947556)
Genome map
AA seq 361 aa AA seqDB search
MATISGTNGDNVLNGTLQDDVILGLLGNDVITDPGGFNRIDGQDGNDTITGGNNVDYIAG
GPGNDTIYGGNGSDQLIGEIGNDTIYGQDGDDYAAGNPGDDVLYGGRGNDFFVGEQGADL
VFGEEGNDFVAGGEDDDTVYGGDGNDLVDGDLGNDVLFGDAGNDVLFGDYGNDRMSGGTG
TNTLDGALGIDTAVFNFNFAQAGVTSAGTLSSIAGQNSLDTVKNTEVFAFADRSILQGDG
NQAVDDLFYLSQYGDVYRNGNDAEQHFSDYGWKEGRNPNAFFDTKGYLAAYADVAAAGIN
PLEHYLTYGWKEGRDPSAQFDTKQYLAANGDVAAAGLNPLLHYLEYGAVEGRATFNDGTF
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatttcgggaaccaacggcgacaacgttctcaacggcacccttcaagatgac
gtgattctcggtctcctcggaaacgatgtcattacggacccgggtggattcaaccggatc
gacggtcaggacggaaacgacacgatcaccggcggaaacaacgtcgattacattgccggc
gggccgggtaacgacacgatttacggtggcaacggatccgaccagctgatcggcgagatc
ggcaatgacacgatctacggtcaggacggcgatgattacgcagccggcaatcccggcgac
gacgtcctatacggcggccggggcaacgactttttcgttggcgagcagggcgctgacctc
gtcttcggcgaagagggcaatgacttcgtcgcgggcggcgaggacgacgacaccgtctac
ggcggcgacggcaacgacctcgtcgacggcgatctcggcaacgatgtcctgttcggcgac
gccggcaacgacgtcctgttcggcgattacggcaacgaccggatgtcgggcggaacgggc
accaacacgctcgacggcgccctcggcatcgacacggcggtgttcaacttcaattttgct
caagcgggcgtgacgtccgcgggcacgctatcgtccatcgccggacagaactcgctcgac
acggtcaagaacacggaagtgttcgccttcgccgaccgctcgatcctgcagggcgacggc
aaccaggccgtggacgacctgttctacctcagccaatacggcgacgtttaccggaacggg
aacgacgccgagcagcacttcagcgattacggctggaaggaaggccgcaacccgaacgcc
ttcttcgacacgaaggggtatctggctgcctacgccgatgttgcggcggccggcatcaat
cccctcgaacactacctcacctacgggtggaaggaaggccgcgatccctcggcccagttc
gacaccaagcagtacctcgccgccaacggcgatgtcgcggcggccgggctcaatcctctg
ctgcactatctcgaatacggcgccgtcgagggccgcgcgacgttcaacgacggcactttc
gcctga

DBGET integrated database retrieval system