KEGG   Mycobacterium chimaera: AN480_17545Help
Entry
AN480_17545       CDS       T04926                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00250  Alanine, aspartate and glutamate metabolism
mchi00280  Valine, leucine and isoleucine degradation
mchi00310  Lysine degradation
mchi00410  beta-Alanine metabolism
mchi00640  Propanoate metabolism
mchi00650  Butanoate metabolism
mchi01100  Metabolic pathways
mchi01120  Microbial metabolism in diverse environments
Module
mchi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AN480_17545
   00650 Butanoate metabolism
    AN480_17545
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AN480_17545
   00280 Valine, leucine and isoleucine degradation
    AN480_17545
   00310 Lysine degradation
    AN480_17545
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AN480_17545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mchi01007]
    AN480_17545
Enzymes [BR:mchi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AN480_17545
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AN480_17545
    2.6.1.48  5-aminovalerate transaminase
     AN480_17545
Amino acid related enzymes [BR:mchi01007]
 Aminotransferase (transaminase)
  Class III
   AN480_17545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AOS94548
UniProt: A0A1Y0TGI9
LinkDB All DBs
Position
3954489..3955829
Genome map
AA seq 446 aa AA seqDB search
MAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKRS
VLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAPE
VYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIVP
AEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPLS
AVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLLR
LQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLTVAAQAAGVIVLTCGMFGNIIR
LLPPLTIGDELLAEGIDILSGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcgctg
gaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccggtc
ttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgacgcg
gtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgagtcg
tacgtcgccgtcgccgagacgctcaaccggatcaccccgggctccggcgagaagcgctcg
gtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcctac
acgcgcaagtccgcggtggtggcgttcaaccacgcctaccacggccgcaccaacctgacg
atggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccggag
gtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctggcc
accgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggcgcc
gacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtgccg
gccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttcatc
gccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacacgag
ggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctgtcg
gcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcggcggcacc
ttcggcggcaaccccctggcctgcgcggcggccttggccacgatcgagacgatcgagagc
gacgggctggtcgagcgggcccagcagctggagcggctgatcaccgaaccgctgctgcgg
ctgcaggccggcgacgaccggatcggcgacgtccgtgggcgcggcgcgatgatcgcgatc
gagttggtgaagtcggggaccgccgagcccgacaaggagctgacccagaagctgaccgtc
gccgcccaggcggccggcgtcatcgtcctgacctgcggcatgtttggcaacatcatccgg
ctgctgccgccgctgaccatcggcgacgagctgctggccgagggaatcgacatcttgagc
gggttgttgcgcgacctgtaa

DBGET integrated database retrieval system