Mesorhizobium ciceri biovar biserrulae: Mesci_4750 Help Entry Mesci_4750        CDS       T01401                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mci  Mesorhizobium ciceri biovar biserrulae Pathway mci01100   Metabolic pathways mci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mesci_4750   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mesci_4750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ADV13859 UniProt:  E8TKN9 LinkDB All DBs Position complement(4878034..4878270) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgtcatcgagcaccttggcgtcgatgcc gacaaagtgacggagcaggcgagcttcatcgatgatctgggcgccgacagcctcgacacg gtcgaactcgtcatggcgttcgaagaagaattcggcgtcgagatccccgacgacgcggcc gagaccatcctgaccgtcggcgatgccgtgaagtacatcgacaaggcttcggcctga

DBGET integrated database retrieval system