KEGG   Mycobacterium canettii CIPT 140060008: BN44_60050Help
Entry
BN44_60050        CDS       T02419                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT (gamma-amino-N-butyrate transaminase) (GABA transaminase) (glutamate:succinic semialdehyde transaminase) (GABA aminotransferase) (GABA-AT)
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00250  Alanine, aspartate and glutamate metabolism
mcq00280  Valine, leucine and isoleucine degradation
mcq00410  beta-Alanine metabolism
mcq00640  Propanoate metabolism
mcq00650  Butanoate metabolism
mcq01100  Metabolic pathways
mcq01120  Microbial metabolism in diverse environments
Module
mcq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN44_60050 (gabT)
   00650 Butanoate metabolism
    BN44_60050 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN44_60050 (gabT)
   00280 Valine, leucine and isoleucine degradation
    BN44_60050 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN44_60050 (gabT)
Enzymes [BR:mcq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN44_60050 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BN44_60050 (gabT)
Amino acid related enzymes [BR:mcq01007]
 Aminotransferase (transaminase)
  Class III
   BN44_60050 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CCK52578
LinkDB All DBs
Position
2954045..2955394
Genome map
AA seq 449 aa AA seqDB search
MASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVAVAEQLNRITPGSGPKRS
VLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKQLATNGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVP
AEGFLPALLDWCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIERARQIERLVTDR
LTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTERLATAAHAAGVIILTCGMFGN
IIRLLPPLTIGDELLSEGLDIVCAILADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctgcagcagagtcggcgcctggtcaccgaaatccccggtcccgcatcgcag
gcactgactcaccgccgggcggcggcggtgtccagcggtgttggggtcaccctgccggtg
ttcgtagcccgcgccggcggcggcatcgtggaagacgtggacggtaaccggctcatcgac
ctgggttcgggcatcgcagtgacgacgatcggcaactcgtcgccacgcgtggtggatgcg
gtgcgcacgcaggtggccgaatttacccacacctgcttcatggtgacgccatacgagggg
tacgtggccgtcgccgagcaactcaaccggattaccccaggttcgggccccaagcgctcg
gtgttgttcaattccggcgccgaggcagtcgagaacgccgtcaagatcgcacgctcctac
accggcaagcccgcggtggtggcgttcgaccacgcctaccacggtcgcaccaacctaacg
atggcgctgaccgccaagtcgatgccctacaagagcggcttcggtccgttcgcgccggag
atctaccgagcgccattgtcttacccctatcgggacggcctcctcgataagcaactggct
accaatggtgagctagccgcggcccgagccatcggcgtcatcgacaagcaggtaggcgcg
aacaacctggccgccctcgtcatcgaaccgatccagggcgaaggcggtttcatcgttccg
gccgaagggttcctacctgccctcctcgattggtgccgcaagaaccatgtggtgttcatc
gccgacgaggtgcaaaccggctttgcccgtaccggggcgatgttcgcctgcgagcacgag
ggccccgacggtctagagcccgacctgatctgcacggccaaaggcatcgccgatggattg
ccgctgtcggcggtcaccggccgcgccgagatcatgaacgccccgcacgtgggcggcctg
ggcggcacgttcggcggcaacccggtggcctgtgcggccgcgctggccaccatcgcaacc
atcgaaagcgacgggctgatcgagcgggcccgccagatcgaacgcctggtgaccgaccgg
ttgacgacgctgcaggccgtcgacgaccggatcggcgacgtgcgtggtcgcggcgccatg
atcgccgtagagctggtcaaatccggaaccaccgagcccgacgccgggctgaccgagcgg
ctggcgaccgcggcccacgccgccggcgtcatcattttgacctgcggcatgttcggcaac
atcatccggctactgccgccgctgaccatcggcgacgagctgctgagtgaggggctggac
atcgtgtgcgcgatcttggccgacctctga

DBGET integrated database retrieval system