KEGG   Musca domestica (house fly): 101896452
Entry
101896452         CDS       T03448                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101896452
   04215 Apoptosis - multiple species
    101896452
SSDB
Motif
Pfam: GOLD_2 CDV3
Other DBs
NCBI-GeneID: 101896452
NCBI-ProteinID: XP_019891253
LinkDB
Position
Unknown
AA seq 201 aa
MAIAYYIPDQAKLLAGRRQNREAANNQRNAASSQTPLTNQSSRPTDATPSSPSATSSDRG
YGTTINVTVPTANTPAEATGCWDFLAQVFCHALRFYHESSQLQPTVIQISVNFQSQTAEA
TTDNNNSTEEATENSTSAESSAGATAAAENLTTPAAANTTTVTGNTNSNSTPVVKKPSHR
RNTNQQDEKSPKTKTHGKRKN
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcaattgcatattatatacccgatcaggcgaaattattggctggacgacgtcaaaat
cgcgaggcagccaataatcaaagaaatgcggcatcaagtcaaacaccactcacaaatcaa
tcatcgaggccgacggatgcaacaccatccagtccatcagcgacatccagcgataggggc
tatggaactaccattaatgtaacagtgcctactgccaatacacccgccgaggccaccggc
tgttgggatttcctggcccaggttttttgtcatgccctgaggttttaccatgaatcatcg
caactgcaaccgacggttatacaaatttccgttaatttccaaagtcaaacggctgaagca
accaccgacaacaacaattcaacagaggaggcaacagaaaattctacctcagcggaaagt
tccgcgggagccacagcggcagcagaaaatttaacaactcctgccgcagctaacacaaca
acggtgacgggaaataccaactccaactcaactcctgttgtcaaaaaaccgtcgcatcga
agaaataccaaccagcaggatgaaaaatcacccaaaaccaaaacccatggcaaaagaaaa
aattaa

DBGET integrated database retrieval system