KEGG   Methylomonas sp. DH-1: AYM39_13245Help
Entry
AYM39_13245       CDS       T04396                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mdh  Methylomonas sp. DH-1
Pathway
mdh00220  Arginine biosynthesis
mdh01100  Metabolic pathways
mdh01110  Biosynthesis of secondary metabolites
mdh01210  2-Oxocarboxylic acid metabolism
mdh01230  Biosynthesis of amino acids
Module
mdh_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mdh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AYM39_13245
Enzymes [BR:mdh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     AYM39_13245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC GFO_IDH_MocA zf_C2H2_6
Motif
Other DBs
NCBI-ProteinID: ANE56048
UniProt: A0A172UA65
LinkDB All DBs
Position
complement(2972920..2973951)
Genome map
AA seq 343 aa AA seqDB search
MVRAGIVGGTGYTGVELLRILVLHPQVEVSVVTSRADAGSRVDQLYPSLRGYCDLQFSPP
ELKYLQGCDVVFFATPNGTAMLMAEALLALGVKVIDLSADFRIKDPAEWQKWYGMQHASP
GLIDEAVYGLPELNREQIKQARLIACPGCYPTAVQLGFLPLLEAGVVDASGLVADVKSGV
SGAGRKAEIASLMSEAGESFKAYAVAGHRHLPEIKQGLARVTGGEVGLTFVPHLTPMIRG
IHATLYARLNASGSDLQALFEQRYREERFVDVLPAGSHADTRNVRGSNRCQIAVHQPQGG
DTVVVLSVIDNLVKGASGQAVQNMNLMFGLAEAAGLETVALYP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtacgagcaggtattgtcggcggcacgggatacaccggtgtcgaattattgagaatt
ctggttttgcatccgcaagttgaagtcagcgtcgtcacctcccgcgccgacgccgggtcg
agggtggaccagttgtatcccagtttgcgcggctattgcgatttgcaattcagtccgccg
gagctgaagtatttgcaaggctgcgacgtggtgttcttcgccacgccgaacggcacggca
atgctgatggccgaagcgttgttggcgctgggtgtcaaagtcatcgatctgtccgccgat
tttcgtatcaaagacccggccgaatggcagaaatggtacggcatgcagcacgccagtccg
ggcctgattgatgaggccgtgtacggtttgccggagctgaaccgggagcagatcaaacag
gcgcgcttgatcgcttgtccaggctgttacccgactgccgtgcaattgggcttcctgcct
ttgctggaggccggggtggtggatgcgagcggcttggtggcggatgtcaaatccggcgtc
agcggtgccggacgcaaagcggaaatagcgtcgctaatgagcgaagccggcgaaagtttc
aaagcctacgcggttgccggccatcgccatttgccggaaataaagcagggattggcgcgc
gtcacgggcggcgaggtgggtctgactttcgtgccgcatttgacgcctatgatacgcggc
atacacgccacgctttatgcgcgtttaaacgctagcggctcggatttacaggcgctgttc
gagcaacgttatcgggaagaacgcttcgtcgacgtgttacccgccggtagccatgccgac
acccgcaacgtgcgcggcagcaaccgctgccaaattgcggtgcatcaaccgcagggcggc
gatacggtggtggttttgtcggtgatcgacaatctggtgaagggcgcttcgggacaggcg
gtgcagaatatgaacttgatgtttggtttggctgaggcggcaggccttgaaacggttgcg
ctttatccttga

DBGET integrated database retrieval system