KEGG   Microplitis demolitor: 103576174
Entry
103576174         CDS       T05600                                 

Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mdl04052]
    103576174
   00536 Glycosaminoglycan binding proteins [BR:mdl00536]
    103576174
Cytokines and growth factors [BR:mdl04052]
 Growth factors
  Growth factors (RTK binding)
   103576174
Glycosaminoglycan binding proteins [BR:mdl00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103576174
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103576174
NCBI-ProteinID: XP_008554491
LinkDB
Position
Unknown
AA seq 229 aa
MSLRWIQENKEAPTCDEESSDIDDSATDDSYDTDSSLDKNDNENSVNQPRKKRNTTRHPT
TTVIFDENGKPVYKTNQLDKSSAGCILWDPRSSVDNPAYGCRLIKFFCRTGYHLTVSPAG
FVRGQTNINDQIALFNVTSVSFGVIRIQNPETGHYLAFNKKGHLYGELKHNKDNTEWEQW
SIGNYEAFRSRKYAKESWWIGIKKNGRPKSGPKTAWGQKAIQFTVIGYN
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagtttgcggtggatccaagaaaacaaggaagcgccaacatgcgacgaggaatcaagt
gacatcgatgacagcgcaactgatgacagttacgacaccgactcgtctttagataaaaat
gataacgagaattcagtcaatcaaccgaggaagaaacgtaatacaactcggcatccaacc
acaacggtgatctttgatgagaacggaaagcctgtttacaaaaccaatcaactggataaa
tcatcagcgggctgcatactctgggatccacgcagttctgtcgataatccggcttacggg
tgccgactaattaaattcttctgtcgtactggctaccatttgactgtttctccagcgggt
ttcgttcgcgggcaaacaaacattaatgaccaaatcgcgttatttaatgttacctcggta
tcttttggggtaatacggatacagaatccggaaactgggcactacttggcgtttaataaa
aaaggtcacctttatggagagttgaaacacaataaagacaatactgagtgggaacaatgg
agtattggaaattatgaggctttcagatcacgtaaatacgccaaggaaagctggtggatt
ggaataaaaaagaatggacgtcctaaatcaggaccgaaaaccgcctggggacagaaagct
attcagtttaccgtaataggatacaattaa

DBGET integrated database retrieval system