KEGG   Monodelphis domestica (opossum): 100011382
Entry
100011382         CDS       T01031                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo04062  Chemokine signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04217  Necroptosis
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04630  JAK-STAT signaling pathway
mdo04659  Th17 cell differentiation
mdo04917  Prolactin signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo04931  Insulin resistance
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04935  Growth hormone synthesis, secretion and action
mdo05145  Toxoplasmosis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05162  Measles
mdo05163  Human cytomegalovirus infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05212  Pancreatic cancer
mdo05221  Acute myeloid leukemia
mdo05223  Non-small cell lung cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdo05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100011382 (STAT3)
   04066 HIF-1 signaling pathway
    100011382 (STAT3)
   04068 FoxO signaling pathway
    100011382 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100011382 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100011382 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100011382 (STAT3)
   04062 Chemokine signaling pathway
    100011382 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100011382 (STAT3)
   04917 Prolactin signaling pathway
    100011382 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100011382 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100011382 (STAT3)
   05206 MicroRNAs in cancer
    100011382 (STAT3)
   05205 Proteoglycans in cancer
    100011382 (STAT3)
   05203 Viral carcinogenesis
    100011382 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100011382 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100011382 (STAT3)
   05221 Acute myeloid leukemia
    100011382 (STAT3)
   05223 Non-small cell lung cancer
    100011382 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100011382 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100011382 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100011382 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    100011382 (STAT3)
   05161 Hepatitis B
    100011382 (STAT3)
   05160 Hepatitis C
    100011382 (STAT3)
   05163 Human cytomegalovirus infection
    100011382 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100011382 (STAT3)
   05169 Epstein-Barr virus infection
    100011382 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100011382 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100011382 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100011382 (STAT3)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100011382 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 DUF4795 AP1AR Baculo_PEP_C Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 100011382
NCBI-ProteinID: XP_001363772
Ensembl: ENSMODG00000028212
LinkDB
Position
2
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEGAEPSSGGGQFETLTFDMDLTSECAASPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcacaatggaaccagctgcagcagctcgatacacgatacctggagcagcttcaccag
ttgtacagcgacagctttcctatggagttgcggcaattcctggccccttggatagagagc
caggactgggcatatgctgccagtaaagagtcacatgccaccttggtcttccataacctc
ttgggtgagattgaccagcaatatagtcgcttcctacaggagtcaaatgtcctctatcaa
cacaacctgagaagaatcaagcagttcctgcagagcagatatcttgaaaagccaatggag
attgccaggattgtggctcggtgcctgtgggaggagtctcgtctccttcagactgcagcc
acagctgcccagcaaggagggcaagccaaccaccccacagctgctgtggtgacagaaaaa
caacagatgctagaacaacacttgcaggatgtgaggaaaagagtacaggatctggaacag
aagatgaaagtggtggagaatctccaggatgactttgatttcaactacaagacactaaaa
agtcaaggagacatgcaagatctcaatggaaacaaccagtcagtgactaggcaaaagatg
cagcagctggaacagatgctgactgccctggaccagatgcgtaggggaattgtgagtgaa
ttagcagggcttctttcagcgatggagtacgtgcagaagactctcacagatgaggagcta
gctgactggaagaggagacaacagattgcttgtattggaggccctcccaacatctgccta
gatcgcctagagaactggataacttccttagctgaatctcagcttcagactcgacagcag
ataaagaagctagaagaattacaacagaaagtttcctacaaaggggaccccattgtccaa
caccgaccgatgctggaagagagaattgtggagctgtttaggaatttaatgaaaagtgcc
tttgttgtggagcggcagccctgcatgcctatgcaccctgatcggcccttggtcatcaag
acgggtgttcagttcactaccaaagtcaggttattggtcaaatttcctgagttaaactat
caactcaaaattaaagtgtgcattgacaaagactctggtgacgttgcagcattaagagga
tcccggaaattcaacattctgggaacaaatacgaaagtgatgaacatggaggaatctaac
aatggcagcctctctgcagagttcaaacacttgaccctgagggagcagagatgtggcaat
ggaggccgggccaattgtgatgcttctctcatagtgactgaagaacttcatctcatcacc
tttgagacagaagtttaccatcaaggcctaaagattgacttggagacacactccttacct
gttgtggtgatctctaacatttgtcagatgccaaatgcctgggcttcaatcctttggtat
aatatgttgaccaataaccccaagaacgttaactttttcacgaagccccctatcgggaca
tgggatcaagttgctgaagtgctaagctggcagttttcttctaccacaaagcggggcttg
agcattgagcagttgactacactagcagagaagctcttaggacctggtgtgaattactca
gggtgccagatcacatgggccaaattttgcaaagaaaacatggctggcaaaggtttctct
ttctgggtttggttggacaacattattgaccttgtgaaaaagtatatcttggcattgtgg
aatgaaggatatataatgggcttcattagcaaggaacgagagagagccatcctgagcacg
aaaccccctgggaccttcctgttgaggttcagcgagagcagcaaagagggaggcatcacc
ttcacatgggtggagaaggatattagtggcaagacccagatccagtcagtggaaccatac
accaaacagcagctgaacaatatgtcctttgccgagatcatcatgggctataaaatcatg
gatgccaccaacatcctggtgtctcccctggtctatctctaccctgacattcccaaggag
gaggcgtttggaaagtattgccggccagagagccaggaacatcctgaagctgacccaggt
gctgccccatacctgaagacaaagtttatctgtgtgaccccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaaggagctgagccctcatcaggagggggacagtttgagaccctcacgtttgacatggac
ttgacttctgagtgtgcagcatcccccatgtga

DBGET integrated database retrieval system