KEGG   Monodelphis domestica (opossum): 100028653
Entry
100028653         CDS       T01031                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04014  Ras signaling pathway
mdo04390  Hippo signaling pathway
mdo04392  Hippo signaling pathway - multiple species
mdo05200  Pathways in cancer
mdo05206  MicroRNAs in cancer
mdo05219  Bladder cancer
mdo05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100028653 (RASSF1)
   04390 Hippo signaling pathway
    100028653 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100028653 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100028653 (RASSF1)
   05206 MicroRNAs in cancer
    100028653 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100028653 (RASSF1)
   05223 Non-small cell lung cancer
    100028653 (RASSF1)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 100028653
NCBI-ProteinID: XP_007499967
UniProt: A0A5F8H5U5
LinkDB
Position
6
AA seq 367 aa
MSAEPELIELRNLVRTPDGLRGPETGRSPGPRSPGRLERANALRIAPGRGPDVLPRGRQV
RLLGGHSDPRLTTGPGRGHCFRPSGPGTHTWCDLCGDFIWGVIRKGLQCIHCKFTCHYRC
RALIRLDCCGPRELSLEPALERDTNVDEPLEWEKPILSQSEIERKIKEYNSQINSNLFMS
LNKDGSYTGFIKVQLKLVRPVSVPATKKPPTLQDAKRPTGKNQAVKRRTSFYLPKDTVKH
LHVLSRTRAREVIEALLRKFLVVDNPRKFALFERAERHDQVYLRKLSDDEQPLRLRLLAG
PSEKALSFVLKENETGDVNWDAFSMPELHNFLRILQREEEEHVRQILQKYSRCRQKMQEA
LGARPLG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtctgcggagcccgagctgatcgagctgcggaacctggtccgcacccccgacgggttg
cgaggaccggagactggccgcagcccgggcccccgaagcccgggccgtctggagcgggcc
aacgcgctgcgcatcgccccgggccgcggcccagatgtgttaccccgcggccgtcaagtc
cgactgctgggcggccacagcgatccccgcctcaccaccggcccaggccggggccattgc
ttccgcccgtcggggcccggcacccacacctggtgcgacctctgcggggacttcatttgg
ggcgtcattcgcaagggcctgcagtgcatccactgcaagtttacttgtcattatcgatgc
cgggccctgatccgcctggactgttgtggtccccgtgaactcagcctggagcctgccttg
gaaagggacaccaacgtggatgagccactggagtgggagaaaccgatcctgtctcaaagt
gagattgagcggaagattaaggaatataacagccagatcaacagcaacctcttcatgagc
ctgaacaaggacggttcctatacgggtttcatcaaggtacagctgaaacttgtgcgcccc
gtatctgtgcctgctaccaagaagccacccaccttgcaggatgccaagcgacccactggg
aagaaccaagcggtgaaacgccgtacctccttttacctccccaaagacacagtcaagcac
ctgcacgtgttgtcccgaacacgagcccgagaggtcatcgaagcgctgctccggaaattc
ctggtggtggataatccccgaaaatttgccctatttgagcgggcagagcgccatgaccaa
gtgtacctacggaagctctccgatgatgaacagcctttgcgattacgcctgctggctgga
cccagcgaaaaagccctgagttttgtcctaaaggagaatgagactggagatgtgaattgg
gatgccttcagcatgcctgaattacataatttccttcgtatcctgcaacgggaggaagaa
gagcatgttcgacaaatcttgcagaagtattctcgttgccgccagaagatgcaggaagcg
ctaggagcccgccccctaggatga

DBGET integrated database retrieval system