KEGG   Monodelphis domestica (opossum): 100032790
Entry
100032790         CDS       T01031                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04915  Estrogen signaling pathway
mdo05200  Pathways in cancer
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05212  Pancreatic cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05223  Non-small cell lung cancer
mdo05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100032790 (TGFA)
   04012 ErbB signaling pathway
    100032790 (TGFA)
   04014 Ras signaling pathway
    100032790 (TGFA)
   04151 PI3K-Akt signaling pathway
    100032790 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100032790 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100032790 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100032790 (TGFA)
   05212 Pancreatic cancer
    100032790 (TGFA)
   05225 Hepatocellular carcinoma
    100032790 (TGFA)
   05214 Glioma
    100032790 (TGFA)
   05211 Renal cell carcinoma
    100032790 (TGFA)
   05215 Prostate cancer
    100032790 (TGFA)
   05223 Non-small cell lung cancer
    100032790 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100032790 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154 UPF0560
Other DBs
NCBI-GeneID: 100032790
NCBI-ProteinID: XP_007476350
Ensembl: ENSMODG00000011562
LinkDB
Position
1
AA seq 160 aa
MVTPAGELALIGLGILLAVCQALENTTSALNAGPPMAAAVVSHFNECPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYIGARCEHADLLAVVAASQKKQTITALVVVSIVALVVLIGVCVL
IHCCRIRRPCEWCRGFICQHEKPSDLLKGGTTCCRSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggttactccggccggggagcttgcactgatcgggctaggtattttattagctgtgtgc
caggccttggagaatacaacatctgccttgaatgcaggtccccctatggcagctgccgtg
gtttcccattttaatgaatgtccagattcccacagtcaattctgctttcatggaacctgt
aggtttttggtgcaggaagacaagccagcatgtgtctgccattctgggtatattggggca
cggtgtgaacatgcagacctccttgcagtggtggcagcaagtcagaagaaacagaccatc
actgccttggtggtagtttccatagtagccttggttgtcctcattggggtctgtgtccta
atacactgctgtcggataaggaggccttgcgagtggtgccggggcttcatctgtcagcat
gagaagcccagtgacctcttgaagggaggaacaacctgttgccgctcagagacagtggtc
tga

DBGET integrated database retrieval system