KEGG   Monodelphis domestica (opossum): 100032988Help
Entry
100032988         CDS       T01031                                 

Gene name
AMY1A
Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
mdo04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100032988 (AMY1A)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100032988 (AMY1A)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100032988 (AMY1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100032988
NCBI-ProteinID: XP_001381892
Ensembl: ENSMODG00000002905
UniProt: F6PNF4
LinkDB All DBs
Position
2
AA seq 511 aa AA seqDB search
MWLLLLLSVLGTCWAQYNPNTQPGRTSIVHLFEWRWDDIALECERYLAPNGFGGVQISPP
NENVVIHNPSRPWWERYQPISYKLCTRSGNEEEFRNMVKRCNDVGVHIYVDAVVNHMCGN
GVTAGRDSTCGSYFNPGKREFPSVPFSGWDFNDGKCKTGSGEIENYGDMYQVRDCRLVGL
LDLALEKDYVRSKVAEYMNHLIDIGVAGFRIDASKHMWPGDMKAFLDQLHDLNRTWFPEG
AKAFIYQEVIDLGGEAIKSSDYFGNGRVTEFKYGAKLGTVLRRWDGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGAAILTFWDSRLYKMGVGFMLAHPYGFTRVMSSFRWP
RYFENGKDINDWVGPPNDNGIIKRVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDYELSFTLQTGLPAGTYCDVISGDKIDNNCTGI
KITVSDSGNAHFKISNTAEDPFIAIHVNAKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttgctgttgctttcagtccttgggacatgctgggcacagtacaatcctaat
acccaaccgggtcgaacatctatagtgcacttatttgaatggcgttgggatgacattgct
ctagaatgtgagcgttacctagctcccaatggctttgggggtgttcagatctcacctcca
aatgagaatgtagtgatccataacccttctagaccctggtgggaaagataccagccaatt
agctacaagctatgcacacggtccggaaatgaagaggaattcagaaacatggtgaaaaga
tgcaacgatgttggagtacacatttacgtggatgctgtagtgaatcacatgtgtgggaat
ggcgtgactgctggaagagatagcacctgtggaagttacttcaatcctggaaagagagaa
tttccttctgttccattctcgggctgggattttaatgatggtaaatgtaagaccggcagt
ggggaaattgaaaactatggtgatatgtatcaggttagagactgccgtttggttggtctt
cttgatctcgccctggagaaggattatgtgcgttccaaggttgctgagtatatgaaccac
ctgattgacattggtgtggcagggttcagaattgatgcttccaaacacatgtggcctgga
gacatgaaggcatttctggatcagctacatgatttaaacagaacctggttccctgaaggg
gccaaagcattcatttatcaggaggtcattgatctaggcggtgaggcaattaaaagcagt
gactactttggaaatggtcgggttaccgaattcaaatatggcgcaaaactgggcacagtt
cttcgcagatgggatggagaaaagatggcttatttaaagaactggggagaaggttggggc
ttcatgccttccgacagagcgcttgtctttgtggataatcatgacaaccagaggggccat
ggagctggaggagcagccattctcactttctgggattccagactatacaaaatgggagtt
ggatttatgcttgctcatccttatggatttacacgagtgatgtcaagcttcaggtggcca
agatactttgagaatggaaaggatattaatgattgggttggaccacccaatgataatgga
ataattaaacgagtcactatcaatccagataccacctgtggcaatgactgggtttgtgaa
catcgttggcgtcaaataaggaatatggttattttccgtaatgtagttgatggccaacct
tttacaaattggtgggataatggaagtaaccaggtggcttttggcaggggtaatagagga
ttcatcgtatttaacaatgatgactatgaattgtcattcactctgcagactggtcttcct
gctggaacctactgtgatgtgatttctggagataaaattgataacaattgtacaggaatt
aaaataacagtttctgacagtggtaatgctcacttcaaaattagtaacactgctgaagat
ccattcattgccatccatgtgaatgctaaattataa

DBGET integrated database retrieval system