KEGG   Monodelphis domestica (opossum): 100619184
Entry
100619184         CDS       T01031                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04060  Cytokine-cytokine receptor interaction
mdo04061  Viral protein interaction with cytokine and cytokine receptor
mdo04151  PI3K-Akt signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04630  Jak-STAT signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04672  Intestinal immune network for IgA production
mdo04940  Type I diabetes mellitus
mdo05135  Yersinia infection
mdo05142  Chagas disease (American trypanosomiasis)
mdo05162  Measles
mdo05166  Human T-cell leukemia virus 1 infection
mdo05200  Pathways in cancer
mdo05320  Autoimmune thyroid disease
mdo05321  Inflammatory bowel disease (IBD)
mdo05330  Allograft rejection
mdo05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100619184 (IL2)
   04151 PI3K-Akt signaling pathway
    100619184 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100619184 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100619184 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100619184 (IL2)
   04660 T cell receptor signaling pathway
    100619184 (IL2)
   04658 Th1 and Th2 cell differentiation
    100619184 (IL2)
   04659 Th17 cell differentiation
    100619184 (IL2)
   04672 Intestinal immune network for IgA production
    100619184 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100619184 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100619184 (IL2)
   05321 Inflammatory bowel disease (IBD)
    100619184 (IL2)
   05330 Allograft rejection
    100619184 (IL2)
   05332 Graft-versus-host disease
    100619184 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100619184 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100619184 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100619184 (IL2)
   05162 Measles
    100619184 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100619184 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mdo04052]
    100619184 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mdo00536]
    100619184 (IL2)
Cytokines and growth factors [BR:mdo04052]
 Cytokines
  Interleukins
   100619184 (IL2)
Glycosaminoglycan binding proteins [BR:mdo00536]
 Heparan sulfate / Haparin
  Cytokines
   100619184 (IL2)
SSDB
Motif
Pfam: IL2 IL15
Other DBs
NCBI-GeneID: 100619184
NCBI-ProteinID: XP_003341421
UniProt: A0A5F8GY47
LinkDB
Position
5
AA seq 142 aa
MSKVPLLLCVALTLAVLAGGAPTSPPPTSLLEYLLLDLQEAHEKLSGVSERMKRYELYVP
SRARSIADLQCFTKELHPVADALKYESREARYIQDHIRNINVTVNRLMGTATTHCQYAVK
IKIRGFFGEWITFCQRLIHLTR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgagcaaggtaccgctcctgttgtgcgtggcactaactcttgctgtgcttgccggcggg
gcgcccacatcgcctcctcccacctccctgctggagtacttgctgctagacttacaagag
gcccacgagaagctcagtggtgtgtcagaaaggatgaagaggtacgagctgtacgtgccc
agtcgggccagaagcatcgctgatcttcagtgttttactaaagaactgcacccggtggct
gatgccttgaagtatgaatcaagagaagctcggtatattcaggaccatatccgcaacatt
aatgtgactgttaacaggttaatgggaaccgcaaccacccactgtcagtatgctgtcaag
attaagatcagaggattttttggagaatggattaccttctgccaaagacttatccactta
actcgatga

DBGET integrated database retrieval system