KEGG   Candidatus Methanoplasma termitum: Mpt1_c05670
Entry
Mpt1_c05670       CDS       T03540                                 

Gene name
pylD
Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mear  Candidatus Methanoplasma termitum
Pathway
mear00300  Lysine biosynthesis
mear01100  Metabolic pathways
mear01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mear00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mpt1_c05670 (pylD)
Enzymes [BR:mear01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Mpt1_c05670 (pylD)
SSDB
Motif
Pfam: AlaDh_PNT_C 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N 3HCDH_N NAD_binding_7 THF_DHG_CYH_C ELFV_dehydrog AdoHcyase_NAD Shikimate_DH ThiF DUF43 Oxidored_nitro XdhC_C Sacchrp_dh_NADP ApbA HI0933_like FAD_binding_3 NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: AIZ56457
UniProt: A0A0A7LDQ5
LinkDB
Position
complement(603146..603964)
AA seq 272 aa
MTRLTDGMVKDIIRSLDSANEMLITLTGMDTIELACDAIGITPDMIDLDGIKVGVVPITA
GKGTISKFSESVAEIVRRIGMEPFVTNGTDVNGLAEALSAKADIVFMADDIKFIAVNTKD
GRYSDNSFATAAGYVSALKGAAKGLKGKDVLVLGAGRVGSIAAELMNEMGAAVTVYDIDR
KAAEELSLRVPIKIADDANAALSSHLLVLNACPGAIDGRFVKKGAIISSPGIPFPFDGLG
IKRAETIINDPLDIGVVVMAVQSASFTRLKNL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgacaagacttaccgacggaatggtcaaggatatcatcaggtccctggacagtgccaac
gagatgctgataaccctgacgggcatggatacgatagagctggcgtgcgatgcgatcggc
atcacgcccgatatgatcgaccttgacgggatcaaggtgggagtagtgcctatcacggcc
ggtaaaggaactatttcaaaattctccgaatctgttgcggaaatagtcagaaggataggg
atggaaccgttcgtcacaaacgggaccgatgtgaacggcctcgcagaagccctctccgcc
aaggcggatattgtttttatggcagacgatatcaaattcatcgcagtcaacactaaagac
ggaagatattcggacaattcgttcgcaacggctgcagggtacgtctcggcactcaaagga
gcggcaaaaggactcaaagggaaagatgtccttgtacttggggcggggagagtgggaagc
atcgccgccgaactcatgaacgagatgggtgcggcagtgacagtttacgatatagacaga
aaggctgcggaagaactttctctccgtgttccgataaagatcgcagacgatgctaatgcg
gccctgtcatcgcatctgcttgtgctcaacgcatgcccgggtgcgatagacgggagattt
gtgaaaaaaggagcaataatatcatctccggggataccgttcccctttgatgggctgggg
atcaaaagggcggagacaataatcaacgaccccctggacataggggttgttgtcatggcg
gtgcagagcgcatctttcacaagactcaaaaatctataa

DBGET integrated database retrieval system