KEGG   Methylobacterium currus: DA075_11490Help
Entry
DA075_11490       CDS       T05184                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mee  Methylobacterium currus
Pathway
mee00010  Glycolysis / Gluconeogenesis
mee00620  Pyruvate metabolism
mee01100  Metabolic pathways
mee01110  Biosynthesis of secondary metabolites
mee01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DA075_11490
   00620 Pyruvate metabolism
    DA075_11490
Enzymes [BR:mee01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DA075_11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: AWB21461
UniProt: A0A2R4WIT6
LinkDB All DBs
Position
1:complement(2410874..2412397)
Genome map
AA seq 507 aa AA seqDB search
MNKPEVFAESRTASPFSARYDNFIGGEWVAPVAGRYFENTSPITGGVICEVARSDAQDIE
RALDAAHAAKDAWGRTAPAERARILLRIADRMEDNLDLIARAETWDNGKPIRETTHADIP
LAIDHFRYFAGCVRAQEGSLSEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASVLLLAELIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYAAQNLIPVTLELGGKSPNIFFADVAAEDDDFLDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFMERAIRRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARAVKEGEFAGGYYMQPTVFRGHNRMRIFQEEIFGPVLSVTTFKDDDEA
LGIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaagtcttcgcggaatccaggaccgcctcgccgttctcggcccgctac
gacaacttcatcggcggcgagtgggtcgccccggtcgcgggccgctacttcgagaacacc
tcgccgatcaccggcggcgtgatctgcgaggtggcccgctcggacgcgcaggacatcgag
cgggcgctcgacgccgcccacgccgccaaggacgcctggggccgcaccgcgccggccgag
cgcgcccgcatcctcctcagaatcgccgaccggatggaggacaacctcgacctgatcgcc
cgggccgagacctgggacaacggcaagccgatccgcgagaccacccacgccgacatcccg
ctcgccatcgaccatttccgctacttcgccggctgcgtccgggcgcaggagggctcgctc
tccgagatcgaccacgacaccgtggcgtatcacttccacgagccgctgggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtctggaagctcgcgcccgccctc
gccgccggcaattgcgtggtgctcaagcccgccgagcagaccccggcctcggtgctgctg
ctcgccgagctgatcggcgacctcctgccgccgggcgtgctcaacatcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcctcgccccgcatcgccaagatcgccttcacc
ggcgagacgacgaccggccggctcatcatgcaatacgcggcgcagaacctgatcccggtg
acgctggagctcggcggcaagtcgccgaacatcttcttcgcggacgtcgccgccgaggac
gacgacttcctcgacaaggcgctcgagggattcacgatgttcgccctcaaccagggcgag
gtctgcacctgcccgagccgggcgctggtccacgaatcgatctacgaccggttcatggag
cgggcgatccggcgcgtcgaggcgatcacgcaaggctcgcccctcgaccccgcgaccatg
atcggcgcccaggcctcctccgagcagctcgagaagatcctgagctacgtcgatatcggc
cgtcaggagggcgccgaatgcctcacgggcggcgcgcgcgccgtgaaggagggcgagttc
gccggcggctactacatgcagccgacggtgttccgcggccataaccggatgcgcatcttc
caggaggagatctttgggcccgtcctgtcggtcacgaccttcaaggacgacgacgaggcg
ctcggaatcgccaacgacaccctctacggcctcggcgccggcgtgtggacccgcgacggc
acccgcgcctaccgcttcggccgggcgatccaggccggccgtgtctggaccaactgctac
cacgcctacccggcccacgccgccttcggcggctacaagcaatccggcatcgggcgcgag
acgcacaagatgatgctcgaccactaccagcagaccaagaaccttctggtcagctactcg
ccgaagaagctcggcttcttctga

DBGET integrated database retrieval system