KEGG   Methanosarcina sp. WH1: MSWH1_3071
Entry
MSWH1_3071        CDS       T03851                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mef  Methanosarcina sp. WH1
Pathway
mef00300  Lysine biosynthesis
mef01100  Metabolic pathways
mef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mef00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSWH1_3071
Enzymes [BR:mef01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSWH1_3071
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AKB23342
UniProt: A0A0E3NVV4
LinkDB
Position
3754122..3754901
AA seq 259 aa
MALLTPEDLENINRQLHEADSAVRRVTGLDIKGVCKDFYGTTPCCEKIGIVPVTSGNGII
GNFSESLHAITEYFGFDSFVTDIPDVSGYYEAVRNGAQIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKDVLAVGLGKVGFPGVAHFVHKGFRVYGYDADSTILEKT
ASSLGITPFDPNNPRKFSIIFEATPCADTVPESVISENCVISTPGIPCAISNELQKKYGV
ELVMEPLGIGTASMLYSIL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctggaaaacattaacagacagcttcatgaagctgat
tctgctgtccggagagttacagggcttgatataaaaggagtctgcaaagacttctacggc
acaaccccatgctgtgaaaaaataggcattgtacctgtgacctcgggaaacgggatcata
ggaaacttctcggaatccctgcatgcaattacagaatatttcggatttgacagttttgtt
acggatattcctgacgtgagcgggtactacgaggcagtaaggaacggagcgcaaattatc
cttatggcggacgacaataccttccttgcccataacctcaaaaacggaaaaatagccaac
aaccagccctgtacaggcataatttatgcggaaatagcctccagatacctgaaagccgat
tcaaaggatgtgcttgctgttggcctgggaaaggtgggctttccgggagtagcgcacttc
gtacataaaggcttcagggtctacggatatgatgctgacagcacaatcctcgagaaaacc
gcatccagcctcgggattactcctttcgaccccaacaaccccagaaaattctccattatt
ttcgaggctaccccctgtgcggacacggtccccgaatccgtgatttcagaaaactgcgta
atttccacccccggaatcccctgtgctatttccaacgagcttcaaaagaagtacggagtt
gaacttgtaatggaacctctcgggatagggacggcatcaatgctgtattcgattctctaa

DBGET integrated database retrieval system