KEGG   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1: MMINT_08900
Entry
MMINT_08900       CDS       T02692                                 

Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mer  Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
Pathway
mer00300  Lysine biosynthesis
mer01100  Metabolic pathways
mer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MMINT_08900
Enzymes [BR:mer01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MMINT_08900
SSDB
Motif
Pfam: 2-Hacid_dh_C Shikimate_DH AdoHcyase_NAD THF_DHG_CYH_C TrkA_N NAD_binding_7 NAD_binding_2 AlaDh_PNT_C DUF1188 Sacchrp_dh_NADP UDPG_MGDP_dh_N F420_oxidored 3HCDH_N ApbA DapB_N
Other DBs
NCBI-ProteinID: AGN26249
UniProt: R9T6N8
LinkDB
Position
complement(893030..893869)
AA seq 279 aa
MIKHVPYASVERDRTLISSIGIDMKGLAYEAVSVIPDSMPLEDFSTAVVPVTSGKGVTPG
FTESVCSILQHLGMKSFITQRTDIAGLSDALAAKADIVFMADDAEFIALNTHTSTFSDNT
RSTALGYFTALKIAANGLQGKEVLLIGAGRVGDKMADMLEAEEAKVTITDIDPLKSRALQ
KKHIDFKVCDDLEKAVRNSTLILNASPGKIPGDWINKGTIVSSPGMPYSFDEEGLKKMKI
LIHDPLQIGVSVMAVWSASLSLYEPPIPIESPVCAEVIL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgataaaacatgtaccgtatgcatcggtggaaagagacaggaccctcatatcatcaata
ggcatagacatgaagggattggcatacgaagctgtgagtgtgattcccgatagtatgcca
ttggaagatttttctaccgctgttgttccagtcacaagcggaaagggtgttacaccagga
ttcacagagtcagtctgttccattctgcaacatcttggtatgaaatcattcattacccag
agaacagatatcgccgggctgtctgatgcactggcagccaaagcagacattgtctttatg
gctgatgacgctgaattcatagcactcaacactcatacgagcacattttcagacaataca
cgctccacagctttaggatactttaccgcgcttaagatcgcagccaatggacttcaggga
aaagaagtgctgctgataggagcaggaagagtcggagacaaaatggctgatatgcttgaa
gcagaggaagcaaaagttacaattacagacattgatcctttaaaatcacgggcactgcag
aaaaaacatattgattttaaagtatgtgatgaccttgaaaaagctgtaagaaattctaca
ttaatcctgaatgcttcacctggaaaaataccaggagactggataaataaagggacgatc
gtgtcttccccgggaatgccttactcttttgatgaagaaggtcttaaaaaaatgaagatt
ctgattcatgacccgctgcagataggcgtgtctgtcatggcagtatggagtgctagtttg
tctttgtatgaaccaccaataccgattgaaagtcctgtctgtgcggaagtgatcctgtga

DBGET integrated database retrieval system