KEGG   Manihot esculenta (cassava): 110621720Help
Entry
110621720         CDS       T05761                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00061  Fatty acid biosynthesis
mesc00780  Biotin metabolism
mesc01100  Metabolic pathways
mesc01212  Fatty acid metabolism
Module
mesc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110621720
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110621720
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    110621720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mesc01004]
    110621720
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     110621720
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     110621720
Lipid biosynthesis proteins [BR:mesc01004]
 Fatty acid synthase
  Component type
   110621720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 110621720
NCBI-ProteinID: XP_021621700
LinkDB All DBs
Position
LG8
AA seq 391 aa AA seqDB search
MAVAATPSTHMATINPCLSSSNKVFMSSIARFNTESKEVSWTRLKSSSHITSKLPFSRSL
TSVPVTYKRVVTRAMSAPNEDKPLPGLPIDLRGKRAFIAGVADDNGYGWAIAKSLAAAGA
EIIVGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKVYPMDAVFDSPEDVPEDVKTN
KRYAGASKWTVQELVGSVKQDFGSIDILVHSLANGPEVSKPLLETSRNGYLAAISASSYS
YVSLLKHFVPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHK
IRVNTISAGPLRSRAAKAIGFIDMMIDYSLANAPLQKELSAEEVGNAAAFLASPLASAIT
GAVVYVDNGLNAMGVGVDSPIFANLDIPKDN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggctgcaactcctagcacacatatggcaacaatcaatccttgcctatcttct
tctaacaaagtatttatgtcaagcatagctcgtttcaatactgagtctaaggaggtgtct
tggactagacttaagagctcctctcacatcacatcaaagctgccattctcacgtagcctg
acttcagtgcctgtaacatataaaagggttgtcactagggcaatgtctgcaccaaatgag
gacaagcctctgcctgggttgcctattgatttaagaggtaagagagcatttattgctggt
gtagctgatgacaatggatatggttgggcaattgcaaaatctcttgctgctgcaggtgct
gagattattgttggtacatgggtgcctgcactgaacatatttgaaagcagtctacggcgt
gggaaatttgatgaatcacgcgtattgccagatggttcattaatggaaattaccaaagtt
tatccaatggatgcagtttttgacagtcctgaggatgttcctgaagatgtaaaaacaaat
aaacgttatgcaggggcctcaaaatggaccgtccaggagcttgttggatcagtaaagcag
gattttggcagcattgacatccttgtgcattcacttgctaatgggccagaggttagcaag
cctcttctagagacatcaaggaatggatatcttgcagccatctctgcgtcaagttactca
tatgtctccttactgaagcattttgttccaataatgaatccaggtggttcttcaatttct
cttacctacattgcctctgaaaggatcattccaggatatggtggaggcatgagttcagca
aaggcagctttagaaagtgacacacgggtgctagcttttgaggctggaagaaaacacaaa
atcagagtcaacaccatttctgcaggtccattgagaagtcgcgcagcaaaagcaatcggc
ttcatcgatatgatgattgattactcgttggcaaatgcacctctacagaaggaactatct
gcagaggaggtgggtaatgcagctgccttcctggcttcaccattggcttcagccattact
ggcgcagttgtgtatgttgacaatggtctaaatgcaatgggagttggagttgacagtcca
atctttgcgaaccttgacatcccaaaggataactga

DBGET integrated database retrieval system