KEGG   Mesorhizobium sp. B7: BSQ44_02770Help
Entry
BSQ44_02770       CDS       T04603                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00500  Starch and sucrose metabolism
meso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meso00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSQ44_02770
Enzymes [BR:meso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BSQ44_02770
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BSQ44_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: APH70420
UniProt: A0A1L3SM23
LinkDB All DBs
Position
544139..547444
Genome map
AA seq 1101 aa AA seqDB search
MKVISNKMDGAIDRSQSDWYRDAIIYQMHVKAFQDSNDDGMGDFAGLMRRLDYIQDLGVT
AIWILPFYPSPLRDDGYDIADYRSINPSYGTMRDFKAFVAEAHRRGLRVITELVINHTSD
QHPWFQKARHAKPGSAARDFYVWSDADTKFPETRIIFLDTETSNWTWDPVAGQFFWHRFY
SHQPDLNFDNPRVLREVLKVMHMWLDAGVDGLRLDAIPYLVEREGTNNENLPETHEVLKK
IRTELDAHYSDRMLLAEANQWPEDTRPYFGEGDECHMGFHFPLMPRIYMALAQEDRYPIS
DIIRQTPEIPEGCQWGIFLRNHDELTLEMVSDQERDYLWRTYAEDKRARINLGIRRRLAP
LLQNDRRKIELLNSLLMSMPGTPIVYYGDELGMGDNYYLGDRDGVRTPMQWSPDLNAGFS
RANPQQLYLPVIMDPIYGYQAVNAESQQRDPSSLLNWMRKLISVRKQHAAFGRGTLTLLY
PRNRKVLAYIREYGNDRILCVANLSRQAQAVELDLSKWKGAVPIELTGRSPFPPVGDLPY
LLTLPAYGFYWLLLAEEAEAPSWHQQVPDILPEFITLTTRDGKVSTALSGSAGATLESEA
LPQFLRLQRWFAAKDQTIKTAKVVPLAEMERGKHLLAECQIDFGEGIQRYLMPLSARWGE
ENLAFGSPTLSYTLAKLRQGPKLGALLDSVHDEDFGKTIIAAMQEGASLEGTAGTVSFDN
NGNPSVYAEAGTPRPLGVEQSNVSIAFGDSIILKVYRRLRSGVQPEVEMARFLTNVGHFD
NMPAYLGAIELAREGDEPTVLASAFEFVRNQGDAWEVLSSALQRDMENADMISTAAPVSE
EEENAFFFPLNLGETLGRRTAELHRALATETDDEAFKAEKTGKSDVKEWVKSARADLDEM
MKALKSARSRYTDRTAEMIGEVLDLKGDLSKRLDACLSHTPSGGRSRIHGDYHLGQVLVA
ADDIVIIDFEGEPRRSIEERRAKMSPLRDVAGMLRSIDYLAADVTRRRGPMAVPADDRAV
ERAELWRQQSRAGFIEAYNSAIEGSPTHPDDEAFARDLLDLFLIQKAAYEVSYELANRPT
WVDIPLRGLLDLVNDNNGAAS
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcagcaacaagatggacggcgcgatcgaccgcagccagtccgattggtac
cgcgacgccataatctaccagatgcacgtcaaggccttccaggactccaacgacgacggc
atgggcgatttcgccggcctgatgcggcggctggattacatccaggatctcggcgtcacc
gcgatctggatcctgcccttctatccttcgccactgcgcgacgacggctacgacatcgcg
gattaccggtcgatcaacccgtcctacggcaccatgcgcgacttcaaggccttcgtggcc
gaagcgcaccggcgcgggctgcgggtcatcaccgaactcgtcatcaaccacacctccgac
cagcatccctggttccagaaggcgcgccacgccaagccgggctcggccgcgcgcgacttc
tacgtctggagcgacgccgacaccaagttccccgaaacccggatcatcttcctcgacacc
gagacgtcgaactggacgtgggacccggtggcgggccagttcttctggcatcgcttctat
tcccaccagccggatctcaacttcgacaatccgcgcgtgctgcgggaagtgctgaaggtc
atgcacatgtggctcgacgcgggcgtcgacgggctgcgcctggatgcgatcccctatctg
gtcgagcgcgagggcaccaacaacgagaacctgcccgagacgcacgaggttctgaagaag
atccgtaccgaactcgacgcgcattattccgatcgtatgctgctcgcggaggccaaccag
tggccggaggacacgcggccctatttcggcgaaggcgacgagtgccacatggggttccac
ttccccctgatgccgcgcatctacatggcgctggcgcaggaggatcgctatccgatctcc
gacatcatccgccagacgccggaaatcccggaagggtgtcagtggggcatcttcctgcgg
aaccacgacgagctcacgctcgaaatggtcagcgaccaggagcgcgactacctctggcgc
acctatgccgaggacaagcgcgcgcgcatcaatctcggcatccgccgccgcctcgccccg
ctgctgcagaacgatcgacgcaagatcgaactcctgaactccctgctgatgtcgatgccc
ggcacgccgatcgtctattacggcgacgagctcggcatgggcgacaactactatctcggc
gatcgcgacggcgttcgcacgcccatgcagtggtcccccgatctcaacgcgggcttctcg
cgcgccaatccgcagcagctctatctgcccgtcatcatggacccgatctacggctaccag
gccgtgaacgcggagagccagcagcgcgacccctcttcgctgctcaactggatgcgcaag
ctgatcagcgtgcgcaagcagcacgcggccttcgggcgcggcacgctgacgctgctttat
ccgcgcaaccgcaaggtcctcgcctacatccgcgaatacggcaacgaccgtatcctgtgc
gtcgccaacctgtcgcgccaggcgcaggcggtcgaactcgacctgtcgaagtggaagggc
gccgtgccgatcgagctcaccggccgctcccccttcccgccggtcggagacctgccgtac
ctgctcactttgccggcttacggtttctactggctgctcctcgccgaagaggcggaggcg
cccagctggcatcagcaggtgccggatatcctgccggaattcatcaccctcaccacgcgt
gacggcaaggtcagcacggcgctgtccggttcggccggcgcgacgctggaaagcgaggcg
ctgccgcagttcctgcgcctgcagcgctggttcgccgccaaggaccagaccatcaagacc
gcgaaggtcgtaccgctcgccgagatggagcgcggcaagcatctgctcgccgaatgccag
atcgacttcggagaaggcatccagcgatatctgatgccgctttcggcccgctggggcgag
gaaaacctcgccttcggttcgccgaccctctcctatacgttggcgaagctgcggcagggc
ccgaagctcggagcgctgctcgacagcgtccacgacgaggatttcggcaagaccatcatc
gcggcgatgcaggaaggcgcttccctcgaggggacggctggcaccgtgtcgttcgacaac
aacggcaatccttccgtctacgcggaggccgggacgccccggccgctcggggtggagcag
agcaacgtctcgatcgccttcggcgattccatcatcctcaaggtctatcgccggcttcgc
agcggcgttcagcccgaagtcgagatggcccgtttcctcaccaatgtcggccacttcgac
aacatgcccgcctatctcggcgcgatcgaactcgcccgcgagggcgacgagccgacggtg
ctcgccagcgccttcgaattcgtccgcaatcagggcgacgcgtgggaggtgctgtcctcg
gcgctccagcgcgacatggaaaacgccgacatgatctcgaccgccgctcctgtgtcggaa
gaggaggagaacgctttcttcttcccgctcaacctcggcgagacgctcggccgtcgcacc
gccgagctgcaccgggcgctcgcgaccgagaccgacgacgaggccttcaaggccgagaag
acgggcaagtccgacgtcaaggaatgggtgaagtccgcccgcgccgatctcgacgagatg
atgaaggcgctgaagtcggcgcgctcgcgctacacggatcgcaccgccgagatgatcggc
gaggtcctcgacctgaagggcgacctgtcgaagcggctggatgcctgcctctcgcacacg
ccgtccggcgggcgctcgcgcatccatggcgactaccatctcggccaggtcctggtggcg
gcggatgatatcgtcatcatcgacttcgagggcgaaccgcgccgctcgatcgaagagcgc
cgggccaagatgtcgccgttgcgcgacgtcgccggtatgctgcggtcgatcgactatctc
gcggccgatgtcacgcgccggcgcggaccgatggcggttccggcggacgatcgtgcggtc
gaacgggccgaactgtggcgccagcagtcgcgggcgggcttcatcgaagcctacaattcc
gcgatcgagggcagtcccacgcatccggacgacgaggcgttcgcgcgcgatctcctcgat
ctcttcctcatccagaaagcagcatacgaggtgagctacgaacttgcgaaccgcccgacc
tgggtggacatcccccttcgcggactgctcgacctcgtcaacgacaacaatggagcagcc
tcatga

DBGET integrated database retrieval system