KEGG   Mesorhizobium sp. WSM1497: A9K65_021030Help
Entry
A9K65_021030      CDS       T04915                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00030  Pentose phosphate pathway
mesw00710  Carbon fixation in photosynthetic organisms
mesw01100  Metabolic pathways
mesw01110  Biosynthesis of secondary metabolites
mesw01120  Microbial metabolism in diverse environments
mesw01130  Biosynthesis of antibiotics
mesw01200  Carbon metabolism
mesw01230  Biosynthesis of amino acids
Module
mesw_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mesw_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
mesw_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mesw_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A9K65_021030
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9K65_021030
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    A9K65_021030
Enzymes [BR:mesw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     A9K65_021030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ARP65564
UniProt: A0A1W6X9R5
LinkDB All DBs
Position
4288833..4290938
Genome map
AA seq 701 aa AA seqDB search
MVQAQLDQLCINTLRMLSIDAVQKANSGHPGTPLDAAPVAYCLWQHFLRYDPADPDWPNR
DRFVLSAGHACALLYSLLHVCGVKAKGPAYPSSDRLAVTLDDLKSFRQAGSHCTGHPEFG
WTSGVETTTGPLGQGAATSVGMAIAERWLAATYNRPDYDLFSHTVYALCSDGDMMEGLSN
EAASLAGHLKLSNLCWIYDDNHITIEGPTGLTFTEDVATRFLAYGWHVERVSDANDLVLL
GKAYQMFIDTHDRPTLIIVQSHIGYGAPHKHDTSKAHGEPLGAEEVRLTKEFYGWDPDAD
FKVPDGVVAHFRSHMGKRGDAAHAAWRKLFAAYRKQYPDLAEQIDQMQRREVAPGWDATL
PAFSADAKGLATRESSGQVLNAIAEHLPWLLGGAADLSPSTKTNLEFDFAGNFQAPEGDQ
AVSYRGRNFHFGLREHAMCAIGNGMSLSKLRPFVSSFLIFTDYCRAALRLSSMMELPLIS
IWTHDSISLGEDGPTHQPIEQLASFRAMPGMIVLRPADANEVMEAWKVIIHLKDRPVCLV
LTRQRVPTLDRSIYANAGGVARGAYVLADAPDARPDVLLLATGSEVALCVTGYEQLKAEG
IKARVVSMPSWELFESQPKEYRDTVLPPTITARVAVEEASGFGWERYTGFDGAILALHSF
GLSAPSKVVAKHFGFEPAHVVAAAKAQIAGIQAPGSAAFTK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggtacaggcgcaactcgaccagctttgcatcaacacgctgcggatgctttccatcgac
gcggtccagaaggcaaattccggccatcccggaacgccgctggatgccgcgccagtcgcc
tactgcctgtggcaacacttcctgcgctatgatccagccgatcccgactggccgaaccgc
gaccgtttcgtgctgtcggccggtcacgcctgcgctctgctctacagcctgcttcatgtg
tgcggcgtcaaggcaaaagggccggcctatccatcgagcgaccggctggccgtgacgttg
gacgatctcaagtcgttccgccaggcaggcagccattgcactggacatcccgaatttggc
tggacctcgggcgtggaaacgaccacggggccactcggacaaggtgccgccacaagcgtc
ggcatggcaattgctgaacggtggctggcggccacctacaatcgacccgattatgatctg
ttctcgcacactgtctatgcgctgtgcagcgacggcgacatgatggaggggctcagcaac
gaggcggcatcgctggctggacacctcaaattgtcgaacctctgctggatttatgacgac
aatcacatcaccatcgaggggccgactggccttaccttcaccgaagacgtggcaacccgc
ttccttgcgtacggatggcatgtcgagcgggtaagcgatgcaaacgatctggtgttgctg
ggcaaggcgtatcagatgttcatcgatacgcatgaccgccccacgctgatcatcgttcaa
agtcatatcggttatggcgcgccgcacaagcatgacaccagcaaagcgcatggcgagccc
ctgggcgccgaagaagttcggctgacgaaggaattctacggctgggatccggacgccgat
ttcaaggttccggacggggtcgtggcgcatttccgctcacatatgggcaagcgtggggac
gccgctcatgccgcctggcgaaaattgttcgctgcctatcgcaaacaatatcctgacctg
gccgaacagatcgatcagatgcagcgacgtgaagttgctcccgggtgggacgccacgttg
cccgccttctcagccgacgcgaaaggcctcgcgacacgtgaatcgtccggccaggtgttg
aacgctattgcggaacatttgccatggctgctgggtggcgcggcagacctgtcgccgtca
accaagacgaacctcgaattcgatttcgccggcaactttcaggcgcccgagggtgaccag
gccgtcagctaccgcgggcggaatttccactttggcctgcgcgaacatgccatgtgcgcc
atcggcaacggcatgagcctgtcgaagctgcggccgttcgtctccagcttcctgatcttc
accgactattgccgcgcggcgctgcggctgagctcgatgatggaactcccgctcatctcc
atctggacccacgattccatcagtctcggcgaggacgggccaacccaccagcccatcgag
cagcttgcctcgttccgcgccatgcccggcatgatcgtgctgcgcccggcggatgcgaat
gaggtcatggaggcatggaaggtcatcattcatctcaaggacaggcccgtctgcctcgta
ctgacgcgacagcgggtgccgacgctcgatcgctcgatctacgcaaacgcaggcggcgtg
gcacggggcgcttatgtactggccgatgctcccgacgcccgacccgacgtcctgctgctg
gcgaccggcagcgaagtcgcgctgtgcgtgacgggctatgaacagttgaaggccgagggc
atcaaggcacgcgtcgtcagcatgccgtcatgggaattgtttgaaagccaaccaaaggag
tatcgcgacaccgtcctgccgccaacgataaccgcccgcgtggcagtggaggaagcatcc
ggtttcggatgggaacggtataccggcttcgacggcgccatcctggctctgcatagcttc
ggcctgtccgctccatcaaaggtcgtcgcaaaacacttcggattcgagcccgcacacgtc
gttgcggctgccaaggcgcaaattgcgggcattcaagctccaggcagtgcggctttcacc
aaatga

DBGET integrated database retrieval system