KEGG   Methylobacterium sp. 17Sr1-43: DK427_00470
Entry
DK427_00470       CDS       T05919                                 

Definition
(GenBank) iron dicitrate transport regulator FecR
  KO
K07165  transmembrane sensor
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_00470
SSDB
Motif
Pfam: FecR DUF4880 DUF4974 Cupin_3 Lyx_isomer
Other DBs
NCBI-ProteinID: AWN34406
UniProt: A0A2U8VLY9
LinkDB
Position
107586..108545
AA seq 319 aa
MREALVGASDTSGASGEDCEDPVYEASAGWVARLSSPDATSSDRQAFEVWRSADPSHGAA
YAEMDALWRKLGHVPDPRQRRRLPKGLAGLAALALSGAALAYQFGLVDRARADLWSGVGE
ITHATLADGSRIDLNTDTALALRFTESGREVEILRGEAFFEVAPDPRRPFVVYGNGLRAR
ALGTRFSVRVDGVERPVDVAEGRVEVTASGRQVQVSAGEAAQLATGSSLSVVKADVGRTT
AWREGRIVFAGERLSAVLAELGRYRRGRIVLLDPAAGERRVTGAFDPHNTDDALNAIAAT
MGVRVTRLTPFLTLVGSPP
NT seq 960 nt   +upstreamnt  +downstreamnt
ttgagggaggcgcttgtgggcgcgagcgatacatccggcgcgtcgggagaagactgcgag
gatccggtctacgaggcctccgcgggctgggtcgcacgtctctcatcgccggatgcgacg
tcgagcgaccggcaggcctttgaggtctggcgctccgccgatccgagccacggagctgcc
tacgccgagatggatgcgctttggcgcaagctcggccacgttcccgacccgcgccagcgt
cgccggctcccgaagggactcgccggcctcgcggctttggccctgtcgggcgccgctctc
gcctaccagttcggcctcgtcgatcgggcgcgggccgatctctggagcggcgtcggcgag
atcacgcacgcgaccctggcggatggcagccgcatcgacctgaacaccgacacggccctc
gccctccgcttcaccgagtccgggcgcgaggtcgagatcctgcgcggcgaggccttcttc
gaggtcgcgcccgacccgcggcgcccgttcgtggtgtacgggaacgggctgcgcgcgcgg
gcactgggcacgcgcttctccgtgcgcgtcgacggggtggagaggcctgtggacgtggcc
gaagggcgcgtcgaggtcacggcgtccggccggcaggtacaggtctcggcgggcgaggcc
gctcagctcgcgacggggagctccctgtcggtcgtcaaggcggatgtgggtcggaccacg
gcctggcgggaggggcgtatcgtcttcgcgggcgagcgtctgtccgcggttctggccgag
ttggggcgctatcgtcgcggccggatcgtcctgctcgatcccgccgcgggcgagcggcgt
gtcacgggggcctttgacccgcacaacacggacgatgccttgaacgcgatcgccgcgacg
atgggggtgcgcgtcacccgtctgactcccttcctcaccctggtcggatcaccgccctga

DBGET integrated database retrieval system