Methylophilus sp. TWE2: ACJ67_02455 Help Entry ACJ67_02455       CDS       T04002                                  Name (GenBank) HIT family hydrolase   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism meu  Methylophilus sp. TWE2 Brite KEGG Orthology (KO) [BR:meu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:meu03016]     ACJ67_02455   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meu04147]     ACJ67_02455 Transfer RNA biogenesis [BR:meu03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     ACJ67_02455 Exosome [BR:meu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    ACJ67_02455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DcpS_C HIT Motif Other DBs NCBI-ProteinID:  AKR42416 UniProt:  A0A0K0ST06 LinkDB All DBs Position 525858..526187 Genome browser AA seq 109 aa AA seqDB search MSADCIFCKIVAGYIPSKTIFQDDEVIAFHDIRPLAKVHFLIVPKAHIETLKDCTAEHQA LLGKMMLLAAQLAAEQGLTGYKTVMNVGREGGQEVFHIHLHVFGGGPAA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagtgcagactgtattttttgcaaaatcgttgcgggttacattccgtcaaaaacgata tttcaagatgacgaggtcattgcgtttcacgacattcgtccattagccaaggtgcatttt ttgattgtgcccaaggcgcatattgaaacgctgaaagattgcacggctgaacatcaggcc ttgttggggaaaatgatgttgcttgctgcccagttagccgctgagcaaggcttgacgggt tacaagactgtcatgaatgttggtcgcgaaggcggccaggaagtgtttcatattcatctg catgtgtttggtggcggacctgccgcctga

DBGET integrated database retrieval system