KEGG   Methanohalobium evestigatum: Metev_0935
Entry
Metev_0935        CDS       T01261                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase NAD-binding protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00300  Lysine biosynthesis
mev01100  Metabolic pathways
mev01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Metev_0935
Enzymes [BR:mev01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Metev_0935
SSDB
Motif
Pfam: NAD_binding_7 NAD_binding_2 2-Hacid_dh_C 3HCDH_N F420_oxidored AlaDh_PNT_C adh_short TrkA_N Shikimate_DH ApbA
Other DBs
NCBI-ProteinID: ADI73829
UniProt: D7E780
LinkDB
Position
complement(894223..895005)
AA seq 260 aa
MTLLTPDDLYNVSRQFEKNNDIIKRATGQGIRDICESVYNTRLGNEKIGIIPITAGNGII
DNFAESLFTITNYLKLDGFITNHTDVAGYYEAVNQNADILLMADDYVFIAHNLRNGKIAT
NHVCTGVIYAEIASRCKYADTKDILVIGLGKVGYAGASHLIRKGFNVYAYDPDNEALNSA
VQELGVHPYDIHRDGKKFCMVFEATPNENTITKDMISERCLVSTPGIPCGLSPELGNDYD
VDLVMEPLLIGVASMLYSVI
NT seq 783 nt   +upstreamnt  +downstreamnt
atgacgttattaacaccagatgatttgtacaatgtatccagacaatttgaaaaaaataat
gacattatcaaaagggctactggtcaagggataagggatatctgtgaatcggtatataat
acaaggcttggaaatgaaaaaatcggaattatacccataacagcaggcaatggaattatt
gataattttgcagaatctctctttacaataacaaattatctgaaactggatggatttatt
acaaatcacactgatgttgccggatattatgaggctgtcaaccaaaatgcagatatttta
ttgatggcggatgattatgttttcattgctcacaatctccgaaacggtaaaattgcaact
aatcatgtctgtacaggagtgatttatgcagaaatagcatccagatgtaaatatgcagat
accaaggatattcttgttataggtcttggtaaggtggggtatgcaggagcatcgcatctg
ataagaaaaggttttaatgtttatgcatatgacccggataatgaggctcttaatagtgct
gtacaggaattgggggtacatccgtacgatatccacagggatggtaaaaagttctgtatg
gtttttgaagccactcccaatgaaaataccattacaaaagatatgatatcagaaagatgc
cttgtgtcaactcccggaattccatgtggactcagtccagagttgggaaatgattatgat
gttgatttggttatggaaccacttcttataggtgttgcttcaatgctttattcggtaatt
taa

DBGET integrated database retrieval system