KEGG   Methanoregula formicica: Metfor_0063Help
Entry
Metfor_0063       CDS       T02392                                 

Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mfo  Methanoregula formicica
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Metfor_0063
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Metfor_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin GIDA Pyr_redox FAD_oxidored Thi4 Lycopene_cycl FAD_binding_2 K_oxygenase HI0933_like GST_N_3 NAD_binding_8 NAD_binding_9 FAD_binding_3 FMO-like Thioredoxin_3 GST_N_2 DUF836 DAO
Motif
Other DBs
NCBI-ProteinID: AGB01149
UniProt: L0HDI0
LinkDB All DBs
Position
complement(57195..58460)
Genome map
AA seq 421 aa AA seqDB search
MYPKVYWDLSKKKVAIRTTATRLMLPAICLYHSGTLSGLMTRVTVYSTQNCPYCRMAKAF
LDKNGVPYESIDVGADAEKAQKMIEISGQRGVPVIVVDSEVIVGFDAERLTELFGKEKAP
DKYDVLIVGAGPAGLTAGVYCARKMLNTLIISENIGGQALESWAIENYMGYRMITGEDLM
KKFEEQVRTFNIRLQLDRVTSVTRNQQDFTVTTATGKTIRARALILTQGKRPRKLDVLGE
ERFIGRGISICSTCDGPLYKGKKIAVVGGGNSAVQTAIEMSRIALSVNLIVRSSIRADPI
YLERLKTIGSIAVHEHTYVTALHGDPFLTGVTIRDANGVERQISLDGIFVEIGWIPNTDI
LDGFVNLNDRGEVIVDINGCTSQPGVFAAGDVTNEKSKQIIIASGDGAKAALEAYEYLMA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaaaggtgtattgggacttgtccaaaaagaaggttgcgataaggacgaccgcc
acccgcctcatgctgccggcaatatgtttatatcattccggaaccctttccggcttaatg
accagagtcaccgtctattctacccagaactgcccctactgccggatggccaaggcgttc
cttgacaagaatggcgtcccctacgagagcatcgatgtgggtgccgatgctgaaaaggca
caaaaaatgatcgagatctccggccagcggggcgtcccggtcattgttgtggacagcgaa
gtgatcgtcgggttcgatgccgagcgcctgacggaactctttgggaaggaaaaggccccg
gacaagtatgacgtcctgattgtcggggccggcccggccggcctcacggcgggagtctat
tgtgcaaggaagatgctcaataccctgattatcagcgagaacatcggcgggcaggcgctg
gagtcgtgggcgatcgagaactacatgggctaccggatgatcacgggggaagacctgatg
aagaagttcgaagagcaggtccgtacattcaacatacggctgcaactggacagggttacc
tcggttacacgcaaccagcaggatttcaccgtaacgacagccacgggcaagaccatccgg
gccagggcacttatcctcacgcagggcaagcggccgcggaagcttgatgttctcggggag
gagcgtttcatcgggcgcgggatctcgatctgttcaacctgcgacggacccctctataaa
ggaaaaaaaatcgcggtcgttggcggcgggaactctgcagtccagaccgcaatcgagatg
agccggattgcattgtcagtcaatctcattgtgcgcagcagcatcagggcggacccgatc
tacctggaacggctgaaaaccattggcagcatcgcagttcacgagcacacgtatgtcacc
gctcttcacggagacccgttcctgaccggtgtcacgatccgcgacgcgaatggtgtggag
cgtcagatcagtcttgacggcatttttgtcgagattggctggatccccaatactgatatc
ctggacggttttgtgaacctgaacgatcgcggggaggtcattgtcgatatcaacggctgc
acaagccagcccggcgtctttgccgcaggcgatgtcaccaatgaaaagagcaaacagatc
atcatcgcatccggggatggggcaaaagcagcgctcgaggcatacgagtacctgatggcg
cagtga

DBGET integrated database retrieval system