KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_3818Help
Entry
Mflv_3818         CDS       T00498                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00250  Alanine, aspartate and glutamate metabolism
mgi00280  Valine, leucine and isoleucine degradation
mgi00410  beta-Alanine metabolism
mgi00640  Propanoate metabolism
mgi00650  Butanoate metabolism
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
Module
mgi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mflv_3818
   00650 Butanoate metabolism
    Mflv_3818
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mflv_3818
   00280 Valine, leucine and isoleucine degradation
    Mflv_3818
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mflv_3818
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgi01007]
    Mflv_3818
Enzymes [BR:mgi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mflv_3818
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mflv_3818
Amino acid related enzymes [BR:mgi01007]
 Aminotransferase (transaminase)
  Class III
   Mflv_3818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABP46290
UniProt: A4TBQ7
LinkDB All DBs
Position
4079953..4081305
Genome map
AA seq 450 aa AA seqDB search
MSALEQSRHLATAIPGPRSVELASRKNTAVSRGVGTTMPVYAARAFGGIVEDVDGNRLID
LGSGIAVTTVGNASPRVVAAVAEQAAEFTHTCFMVTPYEGYVAVAEALNRLTPGDGDKRS
ALFNSGSEAVENAVKIARTFTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
IYRAPMSYPFRDAEFGGKELATDGELAARRAITVIDKQVGAGNLAAVIIEPIQGEGGFIV
PAEGFLPTLLDWCRANDVVFIADEVQTGFARTGAMFACEHEGPDGLVPDLIVTAKGIAGG
MPLSAVTGRADIMDAPHVSGLGGTYGGNPVACAAALATIETIESDNLVARAAQIEALMKD
RLGRMQAEDDRIGDVRGRGAMIAVELVKSGTLEPDPELTRKLLTAAHAAGVIVLSCGTFG
NVLRFLPPLAISDDLLLEGLDILELILRDL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctctcgaacagagccgccacctcgccaccgcgattcccggcccccggtccgtg
gaactggcgagccgaaagaacacggcggtgtcccgcggcgtcggcaccaccatgccggtc
tacgcggcgcgcgccttcgggggcatcgtcgaggacgtcgacggcaaccggctgatcgat
ctgggctccgggatcgcggtcaccaccgtcggcaacgcgtcaccgcgggtggtcgccgca
gtggctgagcaggcggccgagttcacccacacgtgcttcatggtcaccccgtacgaggga
tacgtcgcggtcgccgaggccctcaaccggctgacacccggagacggcgacaagcggtcg
gcgttgttcaactccggctccgaggccgtcgagaacgcggtcaagattgccaggacattc
acacgcaagcaggcggtcgtgtccttcgaccacgcctatcacggccgcaccaacctcacg
atggcgctcaccgcgaagtcgatgccctacaagcacgggttcggacccttcgccccggag
atctaccgtgccccgatgtcctatccgttccgcgacgccgagttcggcggtaaggagctg
gccaccgacggcgagttggccgcgcgtcgtgcgatcaccgtgatcgacaagcaggtcggc
gccggcaatctcgccgcggtgatcatcgagccgatccagggcgagggcggtttcatcgtg
cccgccgagggtttcctgccgacgctgctggactggtgccgggccaatgacgtcgtgttc
atcgccgacgaggtgcagaccgggttcgcgcgcacgggcgcgatgttcgcctgcgagcac
gaaggtcctgacgggttggtccccgacctcatcgtgaccgcgaagggcatcgccggcggc
atgcccctgtcggcggtcaccggccgcgccgacatcatggacgccccgcatgtcagcggc
ctcggcggcacgtacggcggcaacccggtcgcgtgcgcggcggccctcgccaccatcgag
accatcgagtccgacaacctggtggcgcgggcggcgcagatcgaagcgctgatgaaggac
aggctgggtcgcatgcaggccgaggacgaccgcatcggcgatgtccgcggcaggggcgcg
atgatcgccgtcgagctcgtcaagtccggaaccctggagccggacccggagctcacccgg
aagttgctgaccgccgcacacgcggcgggggtcatcgtgttgtcctgcggcacgttcggc
aacgtgctgcgattcctgccgccgctggccatcagcgacgacctcctgctcgaaggcctc
gacatcctcgaactcatcctgcgcgacctgtag

DBGET integrated database retrieval system