KEGG   Meleagris gallopavo (turkey): 100538467
Entry
100538467         CDS       T01523                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp01100  Metabolic pathways
mgp04020  Calcium signaling pathway
mgp04114  Oocyte meiosis
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04371  Apelin signaling pathway
mgp04540  Gap junction
mgp04912  GnRH signaling pathway
mgp04914  Progesterone-mediated oocyte maturation
mgp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100538467 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100538467 (ADCY3)
   04020 Calcium signaling pathway
    100538467 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100538467 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100538467 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100538467 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100538467 (ADCY3)
   04916 Melanogenesis
    100538467 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100538467 (ADCY3)
   04270 Vascular smooth muscle contraction
    100538467 (ADCY3)
Enzymes [BR:mgp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100538467 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1673
Other DBs
NCBI-GeneID: 100538467
NCBI-ProteinID: XP_019468915
LinkDB
Position
2
AA seq 1140 aa
MPRNRDFSEPEYSAEYSADYSVSLPSDPEHAVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLLMCTTVYAADKLAPALAAGTGLAAHVL
LFALCKYRLLPERAARRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAVSCGVHTLVLGVTVAQQRQDALDEGTLLRQILSNIAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTAVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIVTYLIVVPKQPLRNGINGVKLSLTSSHGGSPLLINTKERNGSAILACTSPEES
DESDARVRGTLENGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALL
ERESVQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDP
WLVANYVTFVVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIII
VTTADIVDMLSCQQDYSGTVNGTVVPPRPGGCWEQPKYYSYIAVLALVATIMLVQVSHMV
KLTLMVLITGAAGTVNIYAWEHIFDQYDRRRSQQSMSSLVPSKYSMTAMIFIVMLSFYYF
SRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYS
QSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKT
IGSTYMAASGVTPDANANGYSTKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFNN
FMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVGQHDLGNQGDKL
RIIQKCLQPLKCTVLCTGRESIASSIQQGWDWLTAPPSWEWDKALLKVGHLKTMGSLVGG
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgccgaggaacagggatttctcggagcccgagtactcggccgagtactccgccgactac
tcggtgagcctgccgtcggaccccgagcacgccgtgggccggacccacgaggtgacggtg
cgcagctcggggccgtgcctctgcctgccccgcttcatgcgcctcaccttcgcacccgag
tccctggagaacctctaccagacctacttccgtcggcaacgccacgagaccctcctggtg
ctggtggtcttcgcagccctcttcgattgctacgtcctcctcatgtgtaccacggtctac
gccgccgacaagttggccccggcgttggcagcggggaccggcttggccgcccacgtgttg
ctttttgccctctgcaaatacaggctgctacccgagcgcgccgcccgtcgcttcctgccc
tacgtcctctgggtcctcatcttggcccagatcttctgttacttgggcctcaacttctcg
cgttcgcccgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgttgccgctgcgcctggcgcccatcgtgctcatcaccgccgtgtcctgcggcgtc
cacacgctggtgcttggcgtcaccgtcgcccaacagaggcaggatgccctggatgagggc
acgctgctgagacagatcctgtccaacattgccatctacctttgtgccatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaagcgcggcag
tcccttgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcacgtggcagatgagatgctgaaggatatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccacgagaatgtcagcatc
ctctttgcagacatcgtgggcttcacgcagctctcctcatcctgcagcgcccaggagctg
gtgaagctcctcaacgagctcttcgcccgcttcgacaagctggcagctaaataccaccaa
ctgcgcatcaagatcctgggtgactgctattactgcatctgtgggctgcccgactaccgg
gaggaccatgctgtctgctccatcatgatggggcttgccatggtggaggccatttcttac
gtgcgggaaaagaccaagacagcggtggacatgcgtgtgggagtgcacagcgggacggtg
ctgggcggtgtgctgggccagaagcgttggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggcaggtggcatccctgggcgtgtgcacatctcacagagcacc
atggactgcttgaagggcgagttcgaggtggagccaggtgagggtggctctcgctgcgag
tacctgaaggagaagggcattgtcacctacctcatcgtggtgcccaagcagcctctacgc
aatggcatcaatggcgtgaagctgtcactgacctcatcccatggaggctccccgctgctc
atcaacaccaaggagcgcaatggcagtgccatcttggcgtgcaccagccctgaggagtct
gatgagtctgatgccagggtgaggggcaccctggagaacggggaggaggatggagaggct
gtgaacccatccttccccaacccacggcgccggctgcggctacgggacttggctgagcgg
gtaatcgatgcgtcacagaatgagcaggagctcaacaagctgctcaacgaggccctgctg
gagcgcgagtctgtccaggcgctgaaggggaagagcaccttccggctctccatgcgcttc
attgaccctgagatggagacgcgctactcagtggagaaggagaagcagagcggtgctgct
ttcagctgctcctgtgttgtccttttcttcactgccttggtggaggtcttcatcgaccct
tggttggtggccaactacgtgaccttcgtggtgggggagatcctgctgctcatccttacc
ctctgctcactggctgccatctttccccgggtcttccccaaaaagctcgtggccttctcc
acctggattgacaggactcgctgggcacgcaacacctgggccatggctgccatcatcatt
gtcaccacggctgatattgtggacatgctcagctgtcagcaggactacagcgggacagtc
aatgggacggtggtgccaccacggccaggcggctgttgggagcagcccaagtactacagc
tacatcgccgtgctggccctggtggccaccatcatgctggtgcaggtcagccacatggtc
aagctgactctcatggtgctgatcactggggcagccggcactgtcaacatctacgcctgg
gagcacatcttcgaccagtacgaccgccgccgcagccagcagagcatgtcctcactcgtc
ccttccaagtattccatgacagccatgatcttcatcgtgatgctcagcttttactacttc
tctcgccacgtggaaaagctggccaggacgctcttcctctggaagatcgatgtccacgac
cagaaggagcgggtctatgagatgcggcgctggaacgaggcccttgtcaccaacatgctg
cccgagcatgtggcccggcacttcttgggctccaagaagcgggacgaggagctgtacagc
cagtcctacgatgagattggcgtcatgtttgcttctctccccaacttcgccgacttctac
acagaggagagtatcaacaacgggggcatcgagtgcctgcggttcctcaatgagatcatc
tctgacttcgatgcactcctggatgaaccccaattccggtgtatcaccaaaatcaaaacc
atcggcagcacctacatggctgcgtctggagtgactcctgatgccaacgccaacggctac
agcaccaagaaggagactctctcggataaggagcgctggcagcatttggctgaccttgct
gactttgccttggccatgaaggtgacactgatgaacatcaactaccagtccttcaacaac
ttcatgctgcgcataggcatgaacaagggagctgtgctagcaggagtcattggtgcccgc
aagccacactatgacatctggggcaacacagtgaacgtggccagcaggatggagtccact
ggtgtgatggggaacatacaggtgggacagcacgacctgggcaaccaaggggacaaactg
agaattattcagaagtgtttacagcccttgaagtgcactgtgctttgcacgggaagggaa
agcattgccagcagtattcagcagggctgggactggttgacggctcctccaagctgggaa
tgggacaaggcgttgctaaaagtagggcacctcaagacaatgggcagcttggtgggtggg
taa

DBGET integrated database retrieval system