KEGG   Meleagris gallopavo (turkey): 100538577
Entry
100538577         CDS       T01523                                 

Gene name
DDB1
Definition
(RefSeq) DNA damage-binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100538577 (DDB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100538577 (DDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100538577 (DDB1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100538577 (DDB1)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     100538577 (DDB1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100538577 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100538577 (DDB1)
SSDB
Motif
Pfam: MMS1_N CPSF_A
Other DBs
NCBI-GeneID: 100538577
NCBI-ProteinID: XP_010709065
Ensembl: ENSMGAG00000004990
LinkDB
Position
5
AA seq 1140 aa
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
TAVMELFRPKGESKDLLFILTAKYNACILEYKQNGDNIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRENKELKAFNIRLEELQVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDSHHE
MDNMLVLSFVGQTRVLMLNGEEVEETELTGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPNGKNISVASCNSNQVVVAVGRALYYLEIRPQELRQINCTEMEHEVAC
LDITPLGDTNGMSPLCAIGLWTDISARILKLPSFEMLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLSLETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDASGGTTALRPSASTQALSSSVSTSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFHYSDGKLQSLAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLSHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQIDDGSGMKREATVDDLIKIVEELTRIH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtcgtacaattacgttgtgacggcgcagaagccgacggccgtgaatggctgtgtcacc
ggacacttcacctccgcggaggacctgaacctgctgatcgccaagaacacacgcctggag
atctatgtggtgacagctgaggggctgcggcctgtcaaggaggtgggcatgtatggcaag
actgccgtcatggagctcttccgccccaaaggggagagcaaggatctacttttcatcctg
acagccaagtacaacgcgtgcatcctggagtacaagcagaatggtgacaatattgacatt
atcacccgtgcccatggaaatgtgcaggatcgcatcggtcgtccctcagagactggtatt
atcggcatcattgacccagagtgccggatgattggcctgaggctctatgatggcctcttc
aaggtcatccccctggaccgtgagaacaaggagctgaaggcttttaacatccgcctggag
gagctccaagtcatcgacgtgaagttcctctatggctgtcaggccccaaccatctgcttc
gtctatcaggaccctcagggtcgccacgtcaaaacgtacgaggtgtccctgcgtgagaag
gagtttaacaaaggtccttggaagcaggagaatgtcgaggctgaagcatccatggtcatt
gcagtgccagagccttttggaggcgcaatcatcattggacaggagtccattacctatcac
aatggagataaatacctggctatagctccacccatcatcaagcaaagcacaattgtgtgc
cacaaccgtgtggatcccaatgggtcccgttacttgctgggggacatggaaggacgtctc
ttcatgctgcttctggaaaaggaggagcaaatggatggcacagtcaccctgaaggacttg
cgtgtggaactgcttggtgagacatccattgcagagtgcttgacctacctggacaatggc
gtggtgtttgttggctctcggcttggggattcccagcttgtgaagctcaatgtggacagt
aatgaacaaggctcctatgtagtggctatggagaccttcaccaacctcggtcctatcgtt
gatatgtgtgtggtagacctggagagacaaggccaagggcagttggtcacgtgctcaggt
gcctttaaagagggttcactacggatcatccggaacggcattgggattcatgagcatgcc
agcattgatctgccaggaattaaaggcttgtggcccctgaggtcagattctcatcatgag
atggataatatgctggtgctgtcctttgttggccagaccagggttcttatgttaaatgga
gaggaggtagaagaaacagagctcacagggtttgtggatgatcagcagactttcttctgt
ggcaacgtggcacatcagcaattgatccagatcacctctgcctctgtgagactggtcagt
caggagcccaaagccctcgtgagtgagtggaaagagcccaatgggaagaacattagcgtg
gcttcctgtaacagcaaccaggtggtggtggctgtgggacgagccctctactacctagag
atccgaccccaggagctcaggcagatcaactgcaccgaaatggagcatgaagttgcctgc
ctggacatcactcctttgggggacactaatggcatgtcccctttgtgtgcgattggactc
tggactgatatctctgcccgcatcctaaagcttccttcctttgaaatgctgcacaaagag
atgctaggaggagaaattatccctcgctccatcctgatgacaacctttgagagcagccat
taccttctgtgtgcactgggggacggtgctctcttctactttgggctcagccttgagaca
ggcttgctgagtgaccgtaagaaggtgacccttggcactcagcccacagtcctgaggact
ttccgctccctgtccaccaccaatgtgttcgcctgctctgaccgccccactgtcatctac
agcagtaaccacaagctggtcttctccaatgtcaacctgaaggaggtgaactacatgtgt
cccctcaactcagatgggtatcctgacagcttagcattggctaataacagcacgctgacg
attggcaccattgatgagatccagaagctgcatatccgcacagttcccctctatgaatca
cccaggaaaatctgctaccaagaggtatcacagtgttttggtgtgctctcaagtcgtatc
gaggtgcaagacgccagtgggggcaccactgcactcagacccagtgccagcacccaggcc
ctctctagcagtgtgagtaccagcaagctgttctccagcagcacagcaccacacgagacg
tcctttggagaggaggttgaggtgcacaacctgctcatcatcgatcagcacacttttgaa
gtgcttcatgctcaccagtttctacaaaatgaatacgcccttagcctggtctcctgcaag
cttggcaaagacccaaacacctacttcatcgtgggtaccgccatggtgtatcctgaggag
gcagagccaaagcagggccgcatcgtcgtcttccactactctgatggcaagctgcagagc
ctggctgagaaggaggtgaagggagctgtgtattccatggtggagttcaacgggaagctg
ttagccagcatcaacagcacggtgcgcctgtatgagtggacagctgagaaggagctacgc
acagagtgcaaccattacaataacatcatggctctctacctgaagaccaagggagacttc
atccttgtgggagatctgatgcggtctgtcttgctccttgcctacaagcccatggaagga
aactttgaagagattgcccgggacttcaatccaaactggatgagtgccgtagagatcctg
gacgacgacaacttcttgggagcagaaaatgctttcaacctgtttgtgtgccagaaggac
agtgctgccacgactgatgaggagcgccagcacttgcaggaggtggggctgtcccacttg
ggagagtttgtcaatgtcttctgtcacggctccctggtcatgcagaacctgggcgagaca
tccacaccaacacagggctccgttctctttggcacagtcaacggcatgatagggctggta
acttcgctgtcagagagctggtacaacctcctgctggacatgcagaacaggctgaataaa
gtcatcaagagcgtgggcaagatcgagcactccttctggagatcatttcacactgagcgc
aagacagagccagctacaggcttcattgatggtgacctgattgaaagcttcctggacatc
agcaggcccaagatgcaggaggtggtggcaaacctgcagattgacgatggcagtgggatg
aagagggaggccactgtggatgacctgatcaagattgtggaggaactgacccgcatccac
tag

DBGET integrated database retrieval system