KEGG   Meleagris gallopavo (turkey): 100540056
Entry
100540056         CDS       T01523                                 

Definition
(RefSeq) serine-protein kinase ATM-like
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03440  Homologous recombination
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100540056
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100540056
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100540056
   04210 Apoptosis
    100540056
   04115 p53 signaling pathway
    100540056
   04218 Cellular senescence
    100540056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100540056
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100540056
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100540056
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100540056
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100540056
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100540056
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100540056
SSDB
Motif
Pfam: PI3_PI4_kinase FAT FATC DUF3539
Other DBs
NCBI-GeneID: 100540056
NCBI-ProteinID: XP_019467813
Ensembl: ENSMGAG00000015148
LinkDB
Position
1
AA seq 784 aa
MFQIKQHNPTQYGVSEWQLEEAQVFWAKKEESLALNILKELIKKLDANWFQVENDPHLKL
MYTECLRLCGTWLAETCLENPTIIMQKYLEKAVEIAASHRGDNRDELKKGKTKAFLSLAR
FSDNQYQRIENYMKSSEFENKQALLKKAKEEVGLLRERRVQTNRYTVKVQRELELDECAI
HALTEDRQRFLCKAVENYISCLLSGEEHDMWIFRLCSLWLENSGVDRINEMMKKNAEKIP
SYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLMSRISLDHPHHTLFIILALANANKDELL
TKTDAKRINKLIKNAPKEISQLDVDRMEAARNIINIIRKRRAYMVRDVEALCDAYITLAN
VDATPWKAQRGGISIPADQPIIKLKNLEDVVVPTMEIKVDPTGRYENLVTVRSFKPEFHL
AGGLNLPKIINCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQQNTETRKRKLTI
RRYKVVPLSQRSGVLEWCTGTTPIGEFLVNADKGAHKRYRPHDYSGFQCQKIMMDAQKKH
SEEKYNIFMKVCDNFQPVFRYFCMEKFRDPAVWFEKRLAYTRSVATSSIVGYILGLGDRH
VQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCE
KTMAVMRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADMSSTLGADPRACK
RKASSDDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGW
KPWV
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgtttcagatcaaacaacacaaccccacacaatatggagtttctgaatggcagctagaa
gaagctcaggttttctgggctaaaaaggaagagagccttgcactgaatattctgaaagaa
ttgataaaaaaattagatgcaaattggtttcaggtggagaatgatcctcacctgaaattg
atgtatacagagtgtctgaggctatgtggaacctggttagcagaaacatgtttggaaaac
cctacaatcatcatgcagaaatacttagaaaaggctgtggaaattgctgcaagccaccgt
ggagacaacagagatgaactgaagaaaggaaagacaaaggctttcctgtctttggctcgt
ttctctgataatcagtaccagcgaattgagaattacatgaaatcctcggagtttgaaaat
aagcaggcattactgaagaaggccaaggaggaggttggcctcctgagggagcgtagagtt
cagaccaatagatatacagtgaaggttcagcgagagcttgagctggatgaatgtgccatc
catgccctaactgaggatcgtcagcgtttcttgtgtaaagcagtggagaactacatcagc
tgtttgctcagtggagaggaacatgatatgtggatcttccgactatgttccctatggctt
gaaaattctggagttgacagaatcaatgaaatgatgaagaaaaatgcagagaaaatccct
tcttacaagtttttgcctctgatgtaccagctggctgctcgaatgggaaccaagatgatg
ggtggtctaggattccatgaagttctgaataatctaatgtctaggatttcactggatcac
ccacaccacactttgttcataatactggccttggcaaatgctaacaaagatgaactcctg
acaaaaacagatgcaaaaagaataaataagctaattaaaaatgcaccaaaagaaatttca
cagcttgatgtggacagaatggaggctgctagaaatataatcaacatcataagaaaaagg
agagcttacatggttagagatgtagaagcgctttgtgatgcttacatcacattagcaaat
gtagacgctactccatggaaagcccaaagaggaggaataagtatcccagctgaccagcca
attattaaactgaagaacctggaggatgttgttgttcctaccatggaaattaaggtggat
cccacaggaagatacgaaaatttggtgacagtaaggtcttttaagccagaatttcactta
gcaggaggtctgaatctgccaaaaataataaattgtgtaggatcagatggtaaagaaagg
aggcagctggtgaagggccgtgatgatctgagacaagatgctgttatgcagcaggttttc
cagatgtgtaacacattgctccagcagaacactgaaacacggaagagaaaattaaccatc
cgaagatacaaggtagttcccctttctcagaggagtggtgtgctcgagtggtgcacggga
acaacccccattggggagttccttgtgaatgctgacaagggagcccacaagagatacagg
cctcacgattactccggtttccagtgccagaagataatgatggatgcacaaaagaaacat
tctgaagagaaatacaacatcttcatgaaggtctgtgacaattttcaacctgtgtttcgt
tatttctgcatggaaaaattccgggacccagctgtgtggtttgagaagcggttggcgtac
actcgcagtgtggctacgtcttctatagttggctacatccttggacttggagacagacat
gttcaaaatatcctgatagatgaacaaactgcagaactggtgcatatagatttgggagtt
gcttttgagcaaggtaaaatccttcccacaccagagactgttccatttagattaaccagg
gacattgtggatggaatgggcattactggagtagaaggagtcttcaggagatgctgtgag
aaaacaatggctgtcatgagaaattctcaggaagctttgctgactattgtagaggtgctg
ctctatgatcccctttttgactggaccatgaaccccttgaaagctttatatctgcagcag
agaccagaggacgaggctgacatgagctctactcttggtgctgatccacgagcatgtaaa
aggaaagccagcagtgatgaccagagctttaacaaggtggctgagcgcgttctcatgaga
cttcaggagaagctgaagggcgttgaggagggaacggtgctcagcgtgggagggcaggtg
aacctgctcatacagcaggccatggaccctaaaaacctgagccgcctctttcctggctgg
aaaccctgggtgtga

KEGG   Meleagris gallopavo (turkey): 100540368
Entry
100540368         CDS       T01523                                 

Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03440  Homologous recombination
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100540368
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100540368
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100540368
   04210 Apoptosis
    100540368
   04115 p53 signaling pathway
    100540368
   04218 Cellular senescence
    100540368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100540368
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100540368
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100540368
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100540368
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100540368
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100540368
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100540368
SSDB
Motif
Pfam: HEAT
Other DBs
NCBI-GeneID: 100540368
NCBI-ProteinID: XP_010727333
LinkDB
Position
1
AA seq 1344 aa
MQCTKCLCNCTKNSANKMVSNLFLRLLTSKFINDLLDICKNLMTFTGKPSELGEVDLVGN
DPEESIMEADNQVSDDLFDDHSVTDVSDTNESGEMQNVTGAVSPLAEEQLTKQDLLHLEI
LRFLCICATTVQIQTVSFRASDIQRKLLMLIDGSIFDSAKPLHLHMYLLLLKELPVEENL
LPVDEVLKLLIPLSDVCSLYRRDQDVCKEILSNLLPIAVSLAQSSAHSEETRIAQGRFLT
VVGAFWKLAQGKRCTAPVRVALLNCMKALLEADPYSKWAILNVKNEDLPVSEVFPHFLAD
SHHQVSILAAKSITSLFQDVKQRDSSGLSKPLPLELQQKAFENVYLRVQEGMGNLFSDDA
NPEDVLDKQCNRKAVLLMLITMVLCCSPVCEKQALFAICQSVKENGLEPHLVKKVLKKVS
DIFGYKNIEDFMTSHLDYLVVEWLKIKDSGYSLSAFPYVLLNYTDLEEFYRSCYKVLVPH
LVIRSQFEDVKSLASKIGKDWRQVLADCFPKILVNILPHFAYESHGQREVAEQRETASKV
YDVLKDENCLGKQQIDSLSHNNLSEIVVELLMTLHEPPNAKAEEGSHLSKYVRELDPVPN
PPHFPSYVIKATLDHISNCHKSKLKSLIAVLSKSPDSFQKILLALCKHASDTNNIYKKHR
VLIIYHFFVSLLLKEIKDGLGGAWAFVLRDVIYTLIHHISSRPPVFRDISMRSLSLCCDL
LQRVCHTAVTCCNDALESHLHVIVGTLIPLAVDQPKIQPQILGLLKYLVIDNKDNEYLYQ
AIKRLDPFPEYPAFEELRTTQLKIKYSKGPYSLLEEINRFLSVSVCDSLPLTRLEGLYDL
RKQLEQYKDQMKDLLKIFQEKPEDSVMVKLVVSLLQLSKMAVNHAGEKAVLEAVGSCLGE
IGPMDFSTIALQHAENALDSKAVDLLEDRKLQWVFIMLTQINTALTDNCIDVRSAAVSCL
KNILATNSGSEFWEVYKNKGDPMLIYLQPFRMSKKKVLAMPANDSEASSETLDDTNLWIP
LGESHETWIKNLTRSILDSGGVQNEVLQLMKPLCEVKTDLSQTLLPYLIHDILLHDSNES
WRNILSVHVRKFFTACCRFASSSRSATPPNSDSEQETHVLRSLDKVSRRTMLAVVDYLRR
QKRSVSGTVFDDSFWLDLNYLEVAVAAQSCAAHFTALLYAEIYADKINIDKQQERSSFKA
AKSLTFEEESEKSAIAILNEKSKETGISLQDLLMDIYKSIGEPDSLYGCGGGRMLQPLAR
IRTYEHEAVWDKALLTYDLEATLSPSTRQAGIIEALQNFGLCHTLSMYLKGLEHENTEWC
AELQEIRYQAAWRNMQWDSISSVK
NT seq 4035 nt   +upstreamnt  +downstreamnt
atgcagtgtacaaagtgtttatgcaattgtaccaagaacagtgctaataagatggtgtct
aatttattcctgcgtttgttaacatcaaaatttattaatgatcttctagatatttgcaaa
aatctgatgacttttactggaaaaccaagtgaattaggagaagtagacctagtggggaat
gaccctgaggagagtataatggaagcagataaccaggtatctgatgatctatttgatgat
cactcagtgactgatgtcagtgatacaaatgagtctggtgagatgcaaaatgtaacaggt
gctgtgagcccattagctgaagaacagttgacaaagcaggatttacttcaccttgaaatt
ctgagattcttatgtatttgtgcaactactgtccaaattcagacagtgagctttcgagcc
tctgatatacaaaggaagctgttaatgctcatcgatggcagcatctttgatagtgctaag
ccattgcatctgcacatgtacttgttgctcttgaaggagctccctgttgaagaaaacctg
ctgcctgtggatgaagttcttaagcttcttatacctctttctgatgtatgttctttgtac
cgccgagaccaagatgtttgcaaagaaattctaagtaatttgctaccaatagcagtaagt
ttggcccagtccagtgcacatagtgaagaaacaaggattgcacaagggcgatttttgaca
gttgttggagccttttggaagttagctcaaggaaagagatgcacagcaccagtaagagtg
gcacttttaaactgcatgaaagccctgcttgaggccgatccttattcgaagtgggctatc
cttaatgtaaaaaatgaagatcttcctgtgagtgaggttttcccacattttctcgcagac
agtcaccatcaagtttctattcttgctgcaaagtcaattaccagtttgtttcaagatgtg
aaacagagagattcttctggattgtcaaaacctcttcccttggagctccagcaaaaggct
tttgagaatgtatatctcagggttcaggaaggaatgggaaatctgttcagtgatgatgca
aatcctgaagatgttttggacaaacaatgtaataggaaagcagttttgttgatgcttata
accatggttctgtgctgcagtcctgtatgtgaaaagcaagctttgtttgctatttgccag
tctgtgaaagagaatggattagaacctcaccttgtgaaaaaggttttgaagaaagtatct
gacatctttggctataagaatatagaagacttcatgacatcacacttagactatttggtg
gtggagtggctgaaaataaaggacagtggatatagcttgtctgcctttccttatgttctt
ctgaactacaccgatcttgaggaattttacaggtcttgttataaagttttggttccacac
ctggtgattagaagtcagtttgaagacgtgaaatcacttgctagcaagattggaaaagac
tggaggcaagttctggcagactgttttcccaagatacttgtgaacatcctcccacatttt
gcctatgaaagccacggtcagagggaagtagcagagcaaagagagacagcttctaaagtc
tacgatgtgctcaaggatgaaaactgcttagggaaacagcaaatcgacagtttatctcat
aataatttatcagagattgtggttgaacttctgatgactttacatgaaccacctaacgct
aaggcagaagaaggatctcatctcagtaaatatgttagggaattggatcctgttcctaat
cctcctcattttccttcttatgtgattaaggcaaccttggatcatattagcaactgtcat
aaaagtaaactaaaaagtctcattgcagttctttctaaaagccctgattctttccagaaa
attctgctagccctttgtaagcatgcatcagatacaaacaatatttacaagaagcacaga
gttctcataatttatcacttctttgttagtctgttactcaaagaaataaaagatggttta
ggaggagcatgggcttttgtcctccgagacgtgatttataccctgattcaccacatcagc
agcagaccccctgtctttagagatatatccatgcgcagcttgtcactctgttgtgatctt
cttcagcgtgtttgccacacagcagtgacatgttgcaatgatgctctggagagccacctt
cacgttattgtaggaacactcatacctcttgctgtggaccagcctaagattcagccacag
atcttaggcttgttgaagtacctggtaatagacaataaggataatgaatatctctaccaa
gcaatcaaacgcttagatccttttcctgaatatcctgcttttgaagagttgcgaacaact
caactgaagataaaatacagtaaagggccatattctcttttggaggaaattaatcgcttt
ctgtcagttagtgtttgtgattcactgcccttaacacgacttgaaggactgtatgattta
cgtaaacagttggaacaatataaggaccagatgaaggacctcctgaagatttttcaggaa
aaaccagaagattctgtaatggtgaagctcgtggtgagcttactgcagctgtcaaagatg
gcagttaatcatgcaggtgaaaaagcagtgctggaggctgttggaagttgcttgggagaa
ataggccccatggatttctccaccatcgctcttcagcatgctgaaaatgcactggattct
aaagcagtggacttgcttgaagatagaaagcttcagtgggtcttcataatgttaacacaa
ataaatactgctttaacagataattgtattgatgttagatctgctgctgtttcctgtttg
aaaaacatattagccaccaattctggcagtgaattttgggaagtttataaaaataaaggt
gatcccatgttaatctatctacagcctttcagaatgtccaagaagaaggttttggcaatg
ccagctaatgattcagaggcttcttcagaaactttggatgacacaaacctgtggattcct
ctgggagaaagtcatgaaacctggatcaagaacttaacccgttcaatactggacagtgga
ggtgtacaaaatgaagttctccagttaatgaagccactgtgtgaggtgaaaacggacttg
agtcaaactttgcttccgtacctgattcatgatatccttcttcatgattcaaacgaatct
tggcgaaatattttgtcggttcacgtacggaagttttttactgcctgttgcagatttgcc
tcatctagtagatctgctacaccaccaaattctgactcagagcaagaaacccatgtgctt
agaagtttggataaagtatctcgacgaaccatgcttgctgttgttgattacttaaggagg
caaaaaaggtctgtttcaggtacagtttttgatgacagcttctggctagatctgaattat
cttgaggttgctgtagcagcacagtcttgtgctgcccacttcacagccctgctctatgca
gaaatctacgcagacaagataaatatagacaaacagcaagaaaggtcttcttttaaagca
gctaaaagtttgacatttgaagaagaaagtgaaaaatcagctattgctattttgaatgaa
aaaagtaaagaaactggcataagtttacaggaccttctcatggacatatataaaagtatt
ggagagcctgacagtctctatggttgtggtggaggaagaatgttacagccattagcacgg
ataagaacatatgagcatgaagcagtatgggataaagctcttctaacatacgaccttgag
gcaaccctctctccatctactcgccaagcagggataattgaggctttgcagaattttggg
ctttgccacactctttccatgtatttaaaaggactggaacatgaaaacactgagtggtgt
gcagaactacaggaaatacgctaccaggcagcatggaggaatatgcagtgggacagcatc
tcatctgtcaagtaa

DBGET integrated database retrieval system