Meleagris gallopavo (turkey): 100540547 Help Entry 100540547         CDS       T01523                                  Symbol NXT2 Name (RefSeq) NTF2-related export protein 2   KO K14285   NTF2-related export protein 1/2 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp03008   Ribosome biogenesis in eukaryotes mgp03013   Nucleocytoplasmic transport mgp03015   mRNA surveillance pathway mgp05164   Influenza A Brite KEGG Orthology (KO) [BR:mgp00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100540547 (NXT2)    03015 mRNA surveillance pathway     100540547 (NXT2)    03008 Ribosome biogenesis in eukaryotes     100540547 (NXT2)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100540547 (NXT2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mgp03019]     100540547 (NXT2)    03009 Ribosome biogenesis [BR:mgp03009]     100540547 (NXT2) Messenger RNA biogenesis [BR:mgp03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      100540547 (NXT2) Ribosome biogenesis [BR:mgp03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     100540547 (NXT2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 SnoaL_2 Cofilin_ADF Motif Other DBs NCBI-GeneID:  100540547 NCBI-ProteinID:  XP_010713678 Ensembl:  ENSMGAG00000006597 UniProt:  A0A803YCA1 LinkDB All DBs Position 9:complement(13676651..13749316) Genome browser AA seq 113 aa AA seqDB search MDKRRRALTRLYLDKATLIWNGNAVSGQEALNEFFEMLPSSEFQVNVLDCQPVHEQATQS QTTVLVVTCGTVKFDGNKQRYFNQNFLLTAQATSNSTVWKIASDCFRFQDWAN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggataaaagaagaagggctctgaccaggctgtatttggacaaagcaacgttaatttgg aatggaaacgcagtctctggacaagaggcactgaatgagttttttgaaatgttgccatcc agtgaattccaggttaatgtgttggactgccagcctgttcatgagcaagctactcaaagc cagacaacagtcctcgtggtgacttgtgggacagtaaaatttgatggcaacaagcagcgc tacttcaaccagaacttcttgctgactgcacaagccacatctaacagcacggtgtggaag atcgcgagtgactgtttccgctttcaggactgggccaactag

DBGET integrated database retrieval system