KEGG   Meleagris gallopavo (turkey): 100542960
Entry
100542960         CDS       T01523                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X3
  KO
K07207  tuberous sclerosis 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04140  Autophagy - animal
mgp04150  mTOR signaling pathway
mgp04218  Cellular senescence
mgp04910  Insulin signaling pathway
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100542960 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100542960 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100542960 (TSC2)
   04218 Cellular senescence
    100542960 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100542960 (TSC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100542960 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    100542960 (TSC2)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100542960 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 100542960
NCBI-ProteinID: XP_010717825
Ensembl: ENSMGAG00000005868
LinkDB
Position
16
AA seq 1810 aa
MAKPQSKDSGLKEKFKNLLGLGSSRGSSKSSEGKQTEFIITAEILKELSIECGLSNRIRA
ISQICEVAKTKKIEEHAVEAIWKVVADMLQPERPAEARHAVLHLLKSIIQGQGERLGILR
AHFFKVIKDYPSNEDLHERLEVFKALTENGRYITYLEEELADFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLEDYVADMVHKICILCIQTSSSVDIEISLQVLDAVVCYNCLPSENLPVFI
ITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYMADAALLRGAVFFVG
MALWGAHRLNSLKNSPTSVLPSFLKAMTCPNAVVSYEIVLSITRLIKKYGKELQAVTWDI
LLDIMERLLQQLQSLESQELKSIVHDLLTTVEELCDQNEFHGSEERFFELVERCADQRPE
SSVLNLIAYRAQSIHPAKDGWIHNLQMLMERFFRNESRSAVRIKVLDVLSFVLSINRQFY
EEELINLVVISQLAHIPEDKDHQVRKLATQLLVDLAEGCNTHHFNSLLDIIEKVAAHSLS
SPSELEERDLLSYSASLEDVKTAVLGLLIILQTKLYSLPSSHAMRVYEMLIHHIQRHYMY
AYSLAVASSIRLQVFDFLLMLRADSLHRLGLSNKDGAVRFSPYCLCDFVEAEKRAAEKKP
TGTLSPPSGSPSVPSQNSTIRIGHLPYSMVFGVLLQCLKQETDWKVLKLVLNKLPESLRY
KVLFLTSPCNIDLLASALSYMLTDKKTTDRLHGTPEGFSRTDLHLAVVPVLTALISYHNY
LDKAKQREIVYCLEHGLIYRCANQCVVALSVCSVEMPDIIIKALPVLIVKLTHISATANM
AIPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIR
CRLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSSLRLAKNAKQGLN
NSPPVKELKEPSAVDAFRSRSISVSEHVVRSRIQTSITSSSLGSADENSMAQADDNLKNL
HLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTITTSVGTGTR
SLLGLDSGDLQSSTESGSDPVLQVRQTKEAPAKLESQAGQQVCRSSRNRVRSMSGGHALR
VGALDSTASHFPGGSASQGTQSPPAPASRSEKTNPASQTPLQKEKANLAAYVPLLTQGWA
EILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRETALYKSLSV
PSSSLATGTAKPSLLQRSNTESAVVLEEGSPLEMELKETESPAESPESEDFETSCSEQVL
SEERFGKAQESYSRSSSTSSQDEKSLKSDELVEGGIPIGRVLPAEDGRALEELSFQPSQP
LSKSSSSPELQTLQEILKDANGREVTRRLSTEVKSKSQSGNLEGEGLGSWLSKGEDTRAV
GSGGLDGSGPTTSPRSPSGHRPRGYTISDSAPSRRGKRMERDAFKSRTAATNAEKVPGIN
PSFVFLQLYHSPFFGDENNKPLLLPNETFEKSVQLLDQIPSYDTHKIAVLYVGEGQSNNE
IAILSNEHGSYRYTEFLTGLGKLIELKDCQPDKIYLGGLDVCGEDGQFTYCWHDDIMQAI
FHIATLMPTKDLDKYRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDY
DCNLVTLQCRKDMEGLVDTSVAKIISDKNLPFVARQMALHANMASQVHHSRSNPTDTYPS
KWIARLRHIKRLRHRLREETQYQTPGLPLQMHPSAPTKPSPQMAQDPPPAYETGQRKRLI
SSVDDFTEFV
NT seq 5433 nt   +upstreamnt  +downstreamnt
atggcaaagcctcaaagcaaggattcggggctgaaggagaagttcaagaatctcttgggg
ctgggatcatcccggggaagttcaaagtcatcagagggcaagcaaacggaattcatcatc
actgcagaaatactcaaggaactgagcatagaatgtggattaagtaataggatacgagca
atcagccaaatctgtgaagtggcaaaaacaaaaaaaattgaagagcatgcagtggaagca
atatggaaggtggtagctgatatgctccagccagagcgcccagctgaagccagacatgct
gttcttcatctcctaaagtcaatcattcaagggcagggtgagagattaggaatccttaga
gcacatttttttaaggttattaaggactatccctccaatgaagacttgcatgaacggctt
gaagtgtttaaggctctaacagaaaatggacgatacatcacttacttagaagaagagtta
gctgactttgtgctacagtggatggatgttggtttgtcttcagagttccttttggtttta
gtgaacctggtgaaattcaacagctgctacctggaagactatgtagctgacatggtccac
aagatatgcatcttgtgtattcagacttcatcgtctgtggacattgagatttctttgcaa
gttttagatgctgttgtttgctataactgtctgccatcagagaacctgccagtatttatt
atcacgttgtgccgtaccatcaatgtgaaggaactctgtgagccgtgctggaagcttatg
cgcaaccttctgggaactcatttgggccacagtgcgatttacaacatgtgcaggatcatg
gaagacagagcttacatggcagatgcagccctgctgagaggagcagtgttctttgtaggg
atggctctctggggtgctcatcgcctcaattcactcaagaattccccaacttctgtgcta
ccttcgttcctcaaggccatgacatgtcccaatgcagttgtatcttatgagatagttctg
tccatcactcgcctaataaagaagtatgggaaggaattgcaagctgtaacctgggatatt
ctcttggacatcatggagcgattactgcaacagctgcagagtttagagagccaagaactt
aagtccattgtacatgatcttttgactacagtagaagaactctgtgaccagaatgaattt
catggttctgaggagagattttttgagctggtggaaagatgtgctgatcagagaccggaa
tcttctgtattaaacttgatagcatacagagctcagtccattcatcctgccaaagatggc
tggattcacaacctgcagatgttaatggagagattcttcaggaatgaaagtcgtagtgct
gttcgtattaaagttctggatgtcttgtcctttgtactgagtattaacagacagttctat
gaggaagagctgattaacttggttgtgatctctcaactggctcacattccagaggataaa
gaccatcaagttcgaaaactggccactcagctacttgtagaccttgctgaaggctgcaac
actcatcactttaacagcttgcttgatatcatagaaaaggtggctgcgcattctctctca
tctccatctgagctggaagagagggatttgctatcatattcagcttctttggaagatgtg
aagacagcagttcttggacttctgataattcttcagacaaaactctacagcttaccttcc
agccatgccatgcgggtgtacgagatgctgattcaccacatccagcgccactatatgtat
gcgtacagccttgctgttgctagcagcatcagattgcaggtatttgatttcctcttgatg
cttcgagctgactccctccaccgtcttggcctttctaacaaggatggagcagtgagattc
agcccttactgtctgtgtgattttgtagaagcagagaagagagctgctgagaaaaagcct
actggtacactctctccaccttcaggaagtcccagtgtgccttcccagaacagcaccatt
cgaatagggcatttgccatactcaatggtctttggtgtccttctgcagtgtttgaagcaa
gagacagactggaaggtattgaagttggtcctcaacaaactaccagaatccctccgctat
aaagtgctgtttttaacctctccttgcaacatagacctcctggcttctgcactgagctac
atgctcacagacaagaagacaaccgacaggctccatggtacaccagaaggcttttcccgc
accgatttgcacctggctgtagttccagtactgacagcactgatatcttaccataattat
ctggacaaagctaaacagcgtgaaatcgtgtactgcctggaacatgggcttatctatcgc
tgtgcaaaccagtgcgttgtggcactctctgtctgcagcgttgagatgcctgacatcatc
ataaaggcacttcctgtcctaatagtcaaattaacccacatatctgctacagccaatatg
gcaattcctctcttagaatttctttcaactctagcaaggctgcctcacctctacaggaac
tttgctgcggagcagtatgccagtgtgtttgccatctccctgccatacacaaacccttcc
aagtttaaccagtacatagtttgcctggcccaccacgtgatagctatgtggttcattcgg
tgtcgccttcccttccgaaaggactttgttccctatattacaaagggtttgcgttccaat
gtgctgctctcctttgatgacacacctgagaaggacagtttcagggctcgtagtacaagc
ctcaatgagaggccaaaaagtagtttaagactagcaaaaaatgcaaagcaaggcttgaat
aactctcctccagtgaaagagctgaaagaaccctctgcagttgatgccttccgatcccgc
agcatcagtgtgtctgaacatgtggtccgcagtcggatacagacatccatcactagttcc
agcttgggctctgcagatgaaaattcaatggctcaggctgatgacaacttaaaaaatctc
cacctggaactcactgagacttgtctggatatgatggcccgatacgtcttctccaacttc
accgcggtgcctaagaggtctcctgtgggtgagtttctgttggctggaggaaggacaaaa
acatggctggttggcaacaagctggtgaccatcactacaagtgtcggaacagggacaagg
tccttgcttggcctagactctggagatctccaaagcagcacagaatcaggctcagaccct
gttttgcaagtgagacaaactaaagaagctccagcaaaactcgaatctcaagctgggcag
caggtttgcagaagctctcgcaacagagtcagatccatgtctggtggtcatgccttacgt
gttggtgccttagacagcacagcctcccactttcctggtggctcggcttcccaagggaca
cagagtcctcctgctcctgcatctcggtcagagaagactaatcctgcttcacagacacct
ctgcagaaagaaaaagcaaacttagctgcatatgtcccactgctgacacagggctgggca
gaaatcctcgtgcgcagacccacaggtaacacaagctggctaatgagtctggagaacccg
ctcagtcccttttcttcagacattaacaacatgcccctgcaagagctgtccaatgcactc
atggctgcagagcgttttaaagagcaccgagaaacggctctctacaagtccctgtctgtc
ccctcctccagcttggccactgggacagccaagccttcgcttctccagcgttccaacaca
gagtctgcggtcgtgctggaggaagggagccccttggaaatggagctgaaggaaaccgag
tccccagctgagtctccagagagtgaggattttgagacgtcgtgttctgagcaggtcctg
agcgaggaaaggtttggtaaagcccaggagtcttacagcaggtcgtcctcgacctccagc
caagatgagaaatctctgaagtcagacgagctggtggagggcggtattcccatcgggagg
gtgctgccagcagaggatggccgggcactggaggagctctccttccagccctcccagccg
ctcagcaagtcgagctcttctcccgagctgcagacgctgcaggagatcctcaaggatgca
aatggcagagaagtaacaaggaggctgagcacggaagtgaagtccaaatctcaatctggg
aacctggaaggggaaggactgggcagttggctgagcaagggtgaggacaccagagcagtg
ggctcgggggggttggatggcagtggccccaccacctctccacgctccccatctgggcac
cggcccaggggatacaccatctctgactctgccccatcacggagagggaagaggatggag
agagatgccttcaagagcagaacagcagccaccaatgctgagaaagtacctggaataaac
ccaagctttgtgtttttacaattgtaccattccccgttctttggtgacgaaaacaacaag
ccccttctgttgccaaatgagacgtttgaaaaatcggtgcagcttctggatcaaattcct
tcgtatgacacccacaagatcgcagtgctgtatgttggagagggccagagcaacaatgaa
atcgccattctgtcaaatgagcacggctcctatcgctacaccgagttcctgacaggctta
gggaagctcattgagctcaaagactgccagccagataaaatctacctcggtggcctggat
gtgtgtggggaggatggacagtttacctactgctggcacgatgacatcatgcaagccatt
tttcacattgctacactgatgcccacaaaggatttggataaatatcgctgtgacaagaag
aggcaccttgggaatgattttgtttctattgtttacaatgattctggtgaggacttcaaa
ctgggaacaataaagggtcagttcaattttgtgcacgttatcataacaccacttgactat
gactgcaacctggtcacgctgcagtgtcgaaaagacatggagggccttgtagacacgagt
gttgctaagatcatctctgacaagaacctgccgttcgtcgcccgtcagatggccctgcat
gctaatatggcttcccaggttcaccacagtcgatccaaccctactgacacctacccatcc
aaatggatcgctcggctgcggcacatcaagcggctgaggcaccggctacgtgaagaaacc
cagtaccaaactcctggccttcccctgcagatgcacccatctgctccaacaaagccctct
ccccagatggctcaggacccaccaccagcctacgagaccggtcagaggaagcggctgatc
tcctcagttgatgacttcaccgagttcgtgtag

DBGET integrated database retrieval system