KEGG   Meleagris gallopavo (turkey): 100543068
Entry
100543068         CDS       T01523                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100543068 (CHEK2)
   04115 p53 signaling pathway
    100543068 (CHEK2)
   04218 Cellular senescence
    100543068 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100543068 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543068 (CHEK2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100543068 (CHEK2)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   100543068 (CHEK2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100543068 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like YrbL-PhoP_reg Pkinase_fungal Kdo Pox_ser-thr_kin APH
Other DBs
NCBI-GeneID: 100543068
NCBI-ProteinID: XP_010718647
Ensembl: ENSMGAG00000007024
LinkDB
Position
17
AA seq 396 aa
MGPKNSYVAYIEDHSANGTFMNRELIGKGKRLPLTHNSEIALSFQTNKVFVFSDLTVDDQ
LVFPREFREKYIMSKTLGSGACGEVKLAFEKSTCNKVAVKIINKWKFMASGVREANPAFN
INTEIEILKKIDHPCLIKIKNFFEAEDYYIVLELMEGGELYDRVSRPVKMKEATCKLYFY
QMLLAVKYLHDNGIIHRDLKPENVLLSSSEETCLIKITDFGQSKILGETSLMKTLCGTPT
YLAPEVLNSLGTAGYSRAVDCWSLGVILFVCLCGYPPFSEQNTQLSLKDQITRGEYTFIS
KEWKHVSNMALDLVKKLLVVDPSKRFTIEEALEHPWLQDEDMKNTFQQLLAQTSATMNPP
QTSKMPIAMRKRLHENEDESVSSKHAVPSTSFQKMR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgggaccaaaaaattcgtacgttgcctacattgaagaccacagcgcgaatggaactttc
atgaatagagagctcattgggaaagggaagaggcttccgctgactcataactctgaaatc
gcactgtcctttcagactaacaaggtgtttgtcttttctgatctcacggtggatgaccag
ttggtgtttcctagagaattccgagagaagtatatcatgtctaagactttgggaagtggt
gcctgcggagaagtcaagctggcatttgagaagagcacttgtaataaagttgcagtaaag
ataatcaacaagtggaagtttatggccagtggtgttagagaggcaaacccagcttttaat
atcaacacagaaatagagattttgaagaaaatagatcatccttgcttaatcaagatcaaa
aacttctttgaagcagaggattactacattgttttggaactgatggaaggaggagaattg
tatgacagagtgtcaaggccagtcaagatgaaagaagctacctgcaagttgtacttctat
cagatgctgctggctgtgaagtatcttcatgacaatggaatcatacaccgggatctgaag
ccagagaatgtgctgctttcatcttctgaagagacgtgtctgataaagattacagatttt
ggacaatccaagattcttggagaaacttctcttatgaaaacattatgtggtactcccacg
tatcttgctcctgaggttctaaattcacttgggactgctggatacagccgagctgtggac
tgctggagtttaggagttattctttttgtatgcttgtgtggatatccgccatttagtgag
caaaatactcaactatctctgaaagatcaaatcactcgtggagaatacacattcatttcg
aaagaatggaagcacgtatccaacatggctctggatcttgtgaagaagctgttggtagtg
gatcccagcaaacgttttacgatagaggaagccttagagcatccctggcttcaggatgag
gatatgaaaaatacatttcaacaactacttgctcagacaagtgccactatgaatccacca
caaacatcaaaaatgccaattgctatgagaaaacgtctccatgagaatgaggatgaatct
gtctcttcaaagcacgctgttccttctacatcatttcaaaaaatgaggtga

DBGET integrated database retrieval system